Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.800 8.2e-10
glioblastoma 1.900 6.0e-07
medulloblastoma 1.300 5.3e-05
medulloblastoma, large-cell 1.800 1.9e-07
osteosarcoma -1.611 3.9e-04
pediatric high grade glioma 1.200 4.4e-05
primitive neuroectodermal tumor 1.300 3.0e-05
psoriasis -2.200 1.6e-05

AA Sequence

MEDEEVAESWEEAADSGEIDRRLEKKLKITQKESRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSNG      1 - 70
VVSSPNSTSRPTLPVKSLAQREAEYAEARKRILGSASPEEEQEKPILDRPTRISQPEDSRQPNNVIRQPL     71 - 140
GPDGSQGFKQRR                                                              141 - 152
//

Text Mined References (15)

PMID Year Title