Property Summary

NCBI Gene PubMed Count 17
PubMed Score 26.64
PubTator Score 12.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
cystic fibrosis -1.569 5.8e-06
group 4 medulloblastoma -1.500 2.0e-04
intraductal papillary-mucinous adenoma (... 1.300 2.0e-02
lung adenocarcinoma -1.200 2.5e-10
lung carcinoma -1.700 2.5e-11
medulloblastoma, large-cell -1.800 6.0e-04
non-small cell lung cancer -1.508 4.4e-17
osteosarcoma -1.360 1.2e-02
ovarian cancer 2.100 1.1e-03
spina bifida -1.014 4.2e-02
tuberculosis -1.200 4.9e-03
ulcerative colitis 1.600 1.1e-04

Gene RIF (7)

AA Sequence

MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQYMQLAIREGCG      1 - 70
SPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPYRTWCPVADCQTVCPVASSDPGQP     71 - 140
VLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAEAPIKQCPVCRVYIERNEGCAQMM    141 - 210
CKNCKHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVGLGIIALVTSPLLLLAS    211 - 280
PCIICCVCKSCRGKKKKHDPSTT                                                   281 - 303
//

Text Mined References (18)

PMID Year Title