Property Summary

NCBI Gene PubMed Count 16
Grant Count 6
R01 Count 6
Funding $668,277.5
PubMed Score 26.82
PubTator Score 12.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.360 0.012
cystic fibrosis -1.569 0.000
medulloblastoma, large-cell -1.800 0.001
tuberculosis and treatment for 3 months -1.500 0.001
non-small cell lung cancer -1.508 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.020
lung adenocarcinoma -1.500 0.000
group 4 medulloblastoma -1.500 0.000
lung carcinoma -1.700 0.000
spina bifida -1.014 0.042
ulcerative colitis 1.600 0.000
ovarian cancer 2.100 0.001

Gene RIF (6)

PMID Text
23128396 findings substantiate PIR2/Rnf144b as a potentially critical component of epithelial homeostasis, acting downstream of DeltaNp63alpha to regulate cellular levels of p21(WAF1/CIP1) and DeltaNp63alpha
20615966 PIR2, by being induced by TAp73 and degrading DeltaNp73, differentially regulates TAp73/DeltaNp73 stability.
20615966 PIR2/RNF144B/IBRDC2 regulates the stability of TAp73 and DNp73.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20300062 IBRDC2, an IBR-type RING-finger E3 ubiquitin ligase, regulates the levels of Bax and protects cells from unprompted Bax. activation and cell death.
12853982 p53RFP, a p53-inducible RING-finger protein, regulates the stability of p21WAF1.

AA Sequence

MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQYMQLAIREGCG      1 - 70
SPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPYRTWCPVADCQTVCPVASSDPGQP     71 - 140
VLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAEAPIKQCPVCRVYIERNEGCAQMM    141 - 210
CKNCKHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVGLGIIALVTSPLLLLAS    211 - 280
PCIICCVCKSCRGKKKKHDPSTT                                                   281 - 303
//

Text Mined References (17)

PMID Year Title
23472165 2013 Genome-wide association study link novel loci to endometriosis.
23128396 2013 PIR2/Rnf144B regulates epithelial homeostasis by mediating degradation of p21WAF1 and p63.
20615966 2010 Differential control of TAp73 and DeltaNp73 protein stability by the ring finger ubiquitin ligase PIR2.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20300062 2010 IBRDC2, an IBR-type E3 ubiquitin ligase, is a regulatory factor for Bax and apoptosis activation.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...