Property Summary

NCBI Gene PubMed Count 21
Grant Count 18
R01 Count 14
Funding $2,050,952
PubMed Score 61.40
PubTator Score 33.61

Knowledge Summary

Patent (1,916)

Gene RIF (17)

PMID Text
25324165 Our study shows the presence of several KCNK18 gene mutations in both migraine with aura and migraine without aura
25202008 LQLP site is a fundamental determinant of the calcium-sensitivity of human TRESK.
24972239 This study reveals new pharmacological modulators of K2P18.1 activity useful in dissecting native K2P18.1 function
24805079 Migraine-associated TRESK mutation, but not the C110R variant, reduces the endogenous TRESK currents to a degree that affects trigeminal ganglion neuron excitability
23911303 No association was observed for three polymorphisms in the KCNK18 gene with migraine phenotype or with any haplotypes.
23541583 T cell lymphoblastic leukemias/lymphomas express TRESK protein.
22115960 dominant-negative mutation of human TRESK was found to be linked to migraine with aura in a large pedigree. It is hoped that future TRESK agonists may prevent or ameliorate the debilitating symptoms of migraine.
21855646 A frameshift mutation in the two-pore potassium channel protein TRESK is linked to migraine pathogenesis. (Review)
20871611 a role for TRESK in the pathogenesis of typical migraine with aura.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MEVSGHPQARRCCPEALGKLFPGLCFLCFLVTYALVGAVVFSAIEDGQVLVAADDGEFEKFLEELCRILN      1 - 70
CSETVVEDRKQDLQGHLQKVKPQWFNRTTHWSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFG     71 - 140
IPLMFLVLTDTGDILATILSTSYNRFRKFPFFTRPLLSKWCPKSLFKKKPDPKPADEAVPQIIISAEELP    141 - 210
GPKLGTCPSRPSCSMELFERSHALEKQNTLQLPPQAMERSNSCPELVLGRLSYSIISNLDEVGQQVERLD    211 - 280
IPLPIIALIVFAYISCAAAILPFWETQLDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIVGMEI    281 - 350
VFIAFKLVQNRLIDIYKNVMLFFAKGKFYHLVKK                                        351 - 384
//

Text Mined References (24)

PMID Year Title
25324165 2014 KCNK18 (TRESK) genetic variants in Italian patients with migraine.
25202008 2014 The LQLP calcineurin docking site is a major determinant of the calcium-dependent activation of human TRESK background K+ channel.
24972239 2014 Identification of novel small molecule modulators of K2P18.1 two-pore potassium channel.
24805079 2014 Nonmigraine-associated TRESK K+ channel variant C110R does not increase the excitability of trigeminal ganglion neurons.
23911303 2013 Analysis of 3 common polymorphisms in the KCNK18 gene in an Australian Migraine case-control cohort.
23541583 2013 TRESK potassium channel in human T lymphoblasts.
22115960 2012 TRESK: the lone ranger of two-pore domain potassium channels.
21855646 2011 Migraine: Role of the TRESK two-pore potassium channel.
20871611 2010 A dominant-negative mutation in the TRESK potassium channel is linked to familial migraine with aura.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...