Property Summary

Ligand Count 5
NCBI Gene PubMed Count 22
PubMed Score 66.54
PubTator Score 33.61

Knowledge Summary

Patent (1,916)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
MIGRAINE WITH OR WITHOUT AURA, SUSCEPTIBILITY TO, 13 1 0.0 0.0
Disease Target Count
General anesthesia 53
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Migraine 83 5.595 2.8
Birk-Barel syndrome 8 4.396 2.2

Gene RIF (18)

AA Sequence

MEVSGHPQARRCCPEALGKLFPGLCFLCFLVTYALVGAVVFSAIEDGQVLVAADDGEFEKFLEELCRILN      1 - 70
CSETVVEDRKQDLQGHLQKVKPQWFNRTTHWSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFG     71 - 140
IPLMFLVLTDTGDILATILSTSYNRFRKFPFFTRPLLSKWCPKSLFKKKPDPKPADEAVPQIIISAEELP    141 - 210
GPKLGTCPSRPSCSMELFERSHALEKQNTLQLPPQAMERSNSCPELVLGRLSYSIISNLDEVGQQVERLD    211 - 280
IPLPIIALIVFAYISCAAAILPFWETQLDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIVGMEI    281 - 350
VFIAFKLVQNRLIDIYKNVMLFFAKGKFYHLVKK                                        351 - 384
//

Text Mined References (25)

PMID Year Title