Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.62
PubTator Score 56.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 1.100 5.6e-03
acute quadriplegic myopathy 1.385 2.1e-07
Breast cancer 2.400 3.0e-02
group 3 medulloblastoma 1.100 1.0e-02
invasive ductal carcinoma 1.100 7.2e-03
juvenile dermatomyositis 1.127 1.6e-13
ovarian cancer -1.400 7.2e-05
pancreatic cancer 1.100 4.9e-03
primary pancreatic ductal adenocarcinoma 1.420 1.3e-03

 GO Function (1)

Gene RIF (1)

AA Sequence

MEEKPGQPQPQHHHSHHHPHHHPQQQQQQPHHHHHYYFYNHSHNHHHHHHHQQPHQYLQHGAEGSPKAQP      1 - 70
KPLKHEQKHTLQQHQETPKKKTGYGELNGNAGEREISLKNLSSDEATNPISRVLNGNQQVVDTSLKQTVK     71 - 140
ANTFGKAGIKTKNFIQKNSMDKKNGKSYENKSGENQSVDKSDTIPIPNGVVTNNSGYITNGYMGKGADND    141 - 210
GSGSESGYTTPKKRKARRNSAKGCENLNIVQDKIMQQETSVPTLKQGLETFKPDYSEQKGNRVDGSKPIW    211 - 280
KYETGPGGTSRGKPAVGDMLRKSSDSKPGVSSKKFDDRPKGKHASAVASKEDSWTLFKPPPVFPVDNSSA    281 - 350
KIVPKISYASKVKENLNKTIQNSSVSPTSSSSSSSSTGETQTQSSSRLSQVPMSALKSVTSANFSNGPVL    351 - 420
AGTDGNVYPPGGQPLLTTAANTLTPISSGTDSVLQDMSLTSAAVEQIKTSLFIYPSNMQTMLLSTAQVDL    421 - 490
PSQTDQQNLGDIFQNQWGLSFINEPSAGPETVTGKSSEHKVMEVTFQGEYPATLVSQGAEIIPSGTEHPV    491 - 560
FPKAYELEKRTSPQVLGSILKSGTTSESGALSLEPSHIGDLQKADTSSQGALVFLSKDYEIESQNPLASP    561 - 630
TNTLLGSAKEQRYQRGLERNDSWGSFDLRAAIVYHTKEMESIWNLQKQDPKRIITYNEAMDSPDQ         631 - 695
//

Text Mined References (35)

PMID Year Title