Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.43
PubTator Score 1.03

Knowledge Summary

Patent (393)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 9.97192741060441E-18
interstitial cystitis 2299 2.96039229133618E-5
ulcerative colitis 2087 2.98174004980365E-4
cystic fibrosis 1670 5.32137963761063E-4
osteosarcoma 7933 9.6279574545049E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00863280582385601
fibroadenoma 557 0.0140336392614699
primary Sjogren syndrome 789 0.0155953557372724
breast carcinoma 1614 0.0163147238483627
ductal carcinoma in situ 1745 0.0256097394674998
Disease Target Count Z-score Confidence
Epidermodysplasia verruciformis 21 4.792 2.4
Gas gangrene 15 3.513 1.8

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.347 0.001
pancreatic ductal adenocarcinoma liver m... 1.341 0.009
breast carcinoma 1.200 0.016
fibroadenoma 1.700 0.014
interstitial cystitis -3.200 0.000
cystic fibrosis -1.200 0.001
primary Sjogren syndrome -1.200 0.016
ductal carcinoma in situ 1.400 0.026
ulcerative colitis -1.100 0.000
psoriasis -1.100 0.000

Synonym

Accession Q7Z404 Q7Z5M3 Q8N5E4 Q8TBS7
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid

  TechDev Info (1)

Jing-Ruey Yeh gRNA validated for zebrafish model

AA Sequence

MEENPTLESEAWGSSRGWLAPREARGAPCSSPGPSLSSVLNELPSAATLRYRDPGVLPWGALEEEEEDGG      1 - 70
RSRKAFTEVTQTELQDPHPSRELPWPMQARRAHRQRNASRDQVVYGSGTKTDRWARLLRRSKEKTKEGLR     71 - 140
SLQPWAWTLKRIGGQFGAGTESYFSLLRFLLLLNVLASVLMACMTLLPTWLGGAPPGPPGPDISSPCGSY    141 - 210
NPHSQGLVTFATQLFNLLSGEGYLEWSPLFYGFYPPRPRLAVTYLCWAFAVGLICLLLILHRSVSGLKQT    211 - 280
LLAESEALTSYSHRVFSAWDFGLCGDVHVRLRQRIILYELKVELEETVVRRQAAVRTLGQQARVWLVRVL    281 - 350
LNLLVVALLGAAFYGVYWATGCTVELQEMPLVQELPLLKLGVNYLPSIFIAGVNFVLPPVFKLIAPLEGY    351 - 420
TRSRQIVFILLRTVFLRLASLVVLLFSLWNQITCGGDSEAEDCKTCGYNYKQLPCWETVLGQEMYKLLLF    421 - 490
DLLTVLAVALLIQFPRKLLCGLCPGALGRLAGTQEFQVPDEVLGLIYAQTVVWVGSFFCPLLPLLNTVKF    491 - 560
LLLFYLKKLTLFSTCSPAARTFRASAANFFFPLVLLLGLAISSVPLLYSIFLIPPSKLCGPFRGQSSIWA    561 - 630
QIPESISSLPETTQNFLFFLGTQAFAVPLLLISSILMAYTVALANSYGRLISELKRQRQTEAQNKVFLAR    631 - 700
RAVALTSTKPAL                                                              701 - 712
//

Text Mined References (10)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12906855 2003 Characterization of the transmembrane channel-like (TMC) gene family: functional clues from hearing loss and epidermodysplasia verruciformis.
12812529 2003 TMC and EVER genes belong to a larger novel family, the TMC gene family encoding transmembrane proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.