Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.43
PubTator Score 1.03

Knowledge Summary

Patent (393)

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.347 0.001
pancreatic ductal adenocarcinoma liver m... 1.341 0.009
breast carcinoma 1.200 0.016
fibroadenoma 1.700 0.014
interstitial cystitis -3.200 0.000
cystic fibrosis -1.200 0.001
primary Sjogren syndrome -1.200 0.016
ductal carcinoma in situ 1.400 0.026
ulcerative colitis -1.100 0.000
psoriasis -1.100 0.000

AA Sequence

MEENPTLESEAWGSSRGWLAPREARGAPCSSPGPSLSSVLNELPSAATLRYRDPGVLPWGALEEEEEDGG      1 - 70
RSRKAFTEVTQTELQDPHPSRELPWPMQARRAHRQRNASRDQVVYGSGTKTDRWARLLRRSKEKTKEGLR     71 - 140
SLQPWAWTLKRIGGQFGAGTESYFSLLRFLLLLNVLASVLMACMTLLPTWLGGAPPGPPGPDISSPCGSY    141 - 210
NPHSQGLVTFATQLFNLLSGEGYLEWSPLFYGFYPPRPRLAVTYLCWAFAVGLICLLLILHRSVSGLKQT    211 - 280
LLAESEALTSYSHRVFSAWDFGLCGDVHVRLRQRIILYELKVELEETVVRRQAAVRTLGQQARVWLVRVL    281 - 350
LNLLVVALLGAAFYGVYWATGCTVELQEMPLVQELPLLKLGVNYLPSIFIAGVNFVLPPVFKLIAPLEGY    351 - 420
TRSRQIVFILLRTVFLRLASLVVLLFSLWNQITCGGDSEAEDCKTCGYNYKQLPCWETVLGQEMYKLLLF    421 - 490
DLLTVLAVALLIQFPRKLLCGLCPGALGRLAGTQEFQVPDEVLGLIYAQTVVWVGSFFCPLLPLLNTVKF    491 - 560
LLLFYLKKLTLFSTCSPAARTFRASAANFFFPLVLLLGLAISSVPLLYSIFLIPPSKLCGPFRGQSSIWA    561 - 630
QIPESISSLPETTQNFLFFLGTQAFAVPLLLISSILMAYTVALANSYGRLISELKRQRQTEAQNKVFLAR    631 - 700
RAVALTSTKPAL                                                              701 - 712
//

Text Mined References (10)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12906855 2003 Characterization of the transmembrane channel-like (TMC) gene family: functional clues from hearing loss and epidermodysplasia verruciformis.
12812529 2003 TMC and EVER genes belong to a larger novel family, the TMC gene family encoding transmembrane proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.