Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.76
PubTator Score 1.03

Knowledge Summary

Patent (393)

Expression

  Differential Expression (10)

Disease log2 FC p
breast carcinoma 1.200 1.6e-02
cystic fibrosis -1.200 5.3e-04
ductal carcinoma in situ 1.400 2.6e-02
fibroadenoma 1.700 1.4e-02
interstitial cystitis -2.400 5.5e-03
osteosarcoma -1.347 9.6e-04
pancreatic ductal adenocarcinoma liver m... 1.341 8.6e-03
primary Sjogren syndrome -1.200 1.6e-02
psoriasis -1.100 1.0e-17
ulcerative colitis -1.100 3.0e-04

Gene RIF (1)

AA Sequence

MEENPTLESEAWGSSRGWLAPREARGAPCSSPGPSLSSVLNELPSAATLRYRDPGVLPWGALEEEEEDGG      1 - 70
RSRKAFTEVTQTELQDPHPSRELPWPMQARRAHRQRNASRDQVVYGSGTKTDRWARLLRRSKEKTKEGLR     71 - 140
SLQPWAWTLKRIGGQFGAGTESYFSLLRFLLLLNVLASVLMACMTLLPTWLGGAPPGPPGPDISSPCGSY    141 - 210
NPHSQGLVTFATQLFNLLSGEGYLEWSPLFYGFYPPRPRLAVTYLCWAFAVGLICLLLILHRSVSGLKQT    211 - 280
LLAESEALTSYSHRVFSAWDFGLCGDVHVRLRQRIILYELKVELEETVVRRQAAVRTLGQQARVWLVRVL    281 - 350
LNLLVVALLGAAFYGVYWATGCTVELQEMPLVQELPLLKLGVNYLPSIFIAGVNFVLPPVFKLIAPLEGY    351 - 420
TRSRQIVFILLRTVFLRLASLVVLLFSLWNQITCGGDSEAEDCKTCGYNYKQLPCWETVLGQEMYKLLLF    421 - 490
DLLTVLAVALLIQFPRKLLCGLCPGALGRLAGTQEFQVPDEVLGLIYAQTVVWVGSFFCPLLPLLNTVKF    491 - 560
LLLFYLKKLTLFSTCSPAARTFRASAANFFFPLVLLLGLAISSVPLLYSIFLIPPSKLCGPFRGQSSIWA    561 - 630
QIPESISSLPETTQNFLFFLGTQAFAVPLLLISSILMAYTVALANSYGRLISELKRQRQTEAQNKVFLAR    631 - 700
RAVALTSTKPAL                                                              701 - 712
//

Text Mined References (11)

PMID Year Title