Property Summary

NCBI Gene PubMed Count 24
Grant Count 26
R01 Count 14
Funding $3,193,746.51
PubMed Score 143.44
PubTator Score 50.41

Knowledge Summary

Patent (5,150)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 2.900 0.000
osteosarcoma -2.356 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.010
active ulcerative colitis 1.081 0.010
group 3 medulloblastoma -1.100 0.028
gastric carcinoma 1.200 0.008

 GO Process (1)

Gene RIF (15)

PMID Text
26227733 TMC6/EVER1 and TMC8/EVER2 are known to be involved in the development of EV.
26126409 Findings suggest that SNP in EVER 1 may be involved in the development of premalignant skin lesions that harbour beta-HPV, perhaps giving rise to SCC tumours that have lost beta-HPV gene expression during progression
26047157 TMC6 variants are associated with diminished age-of-onset of P. aeruginosa airway infection in children with cystic fibrosis.
25378492 Expression of both EVER1 and EVER2 in B cells is activated immediately after Epstein-Barr virus (EBV) infection, whereas at later stages, it is strongly repressed by latent membrane protein 1-activated NF-kappaB signaling.
23535066 We report a case of Merkel cell polyomavirus detection in the skin of a patient with epidermodysplasia verruciformis (EDV) and a family history remarkable for an unusual inheritance pattern for EDV.
23534907 EV is also a rare autosomal recessive genodermatosis involving susceptibility to human papillomavirus (HPV) infections and squamous cell carcinoma, caused in most cases by homozygous mutations in EVER1 or EVER2.
22761942 EVER proteins appear as key components of the activation-dependent regulation of Zn(2+) concentration in T cells. However, the impact of EVER-deficiency in T cells on EV pathogenesis remains to be elucidated
21387292 Data support the involvement of the TMC6/8 region in cervix cancer susceptibility.
19706093 epidermodysplasia verruciformis in a father and a son with typical histologic and clinical findings that occur in the absence of mutations in EVER1
18158319 HPV16 E5 protein binds to EVER and ZnT-1 and blocks their negative regulation
More...

AA Sequence

MAQPLAFILDVPETPGDQGQGPSPYDESEVHDSFQQLIQEQSQCTAQEGLELQQREREVTGSSQQTLWRP      1 - 70
EGTQSTATLRILASMPSRTIGRSRGAIISQYYNRTVQLRCRSSRPLLGNFVRSAWPSLRLYDLELDPTAL     71 - 140
EEEEKQSLLVKELQSLAVAQRDHMLRGMPLSLAEKRSLREKSRTPRGKWRGQPGSGGVCSCCGRLRYACV    141 - 210
LALHSLGLALLSALQALMPWRYALKRIGGQFGSSVLSYFLFLKTLLAFNALLLLLLVAFIMGPQVAFPPA    211 - 280
LPGPAPVCTGLELLTGAGCFTHTVMYYGHYSNATLNQPCGSPLDGSQCTPRVGGLPYNMPLAYLSTVGVS    281 - 350
FFITCITLVYSMAHSFGESYRVGSTSGIHAITVFCSWDYKVTQKRASRLQQDNIRTRLKELLAEWQLRHS    351 - 420
PRSVCGRLRQAAVLGLVWLLCLGTALGCAVAVHVFSEFMIQSPEAAGQEAVLLVLPLVVGLLNLGAPYLC    421 - 490
RVLAALEPHDSPVLEVYVAICRNLILKLAILGTLCYHWLGRRVGVLQGQCWEDFVGQELYRFLVMDFVLM    491 - 560
LLDTLFGELVWRIISEKKLKRRRKPEFDIARNVLELIYGQTLTWLGVLFSPLLPAVQIIKLLLVFYVKKT    561 - 630
SLLANCQAPRRPWLASHMSTVFLTLLCFPAFLGAAVFLCYAVWQVKPSSTCGPFRTLDTMYEAGRVWVRH    631 - 700
LEAAGPRVSWLPWVHRYLMENTFFVFLVSALLLAVIYLNIQVVRGQRKVICLLKEQISNEGEDKIFLINK    701 - 770
LHSIYERKEREERSRVGTTEEAAAPPALLTDEQDA                                       771 - 805
//

Text Mined References (26)

PMID Year Title
26227733 2015 Risk of Cutaneous Squamous Cell Carcinoma Development in Renal Transplant Recipients Is Independent of TMC/EVER Alterations.
26126409 2015 Genetic variations in the epidermodysplasia verruciformis (EVER/TMC) genes, cutaneous human papillomavirus infection and squamous cell carcinoma of the skin.
26047157 2015 Exome Sequencing of Phenotypic Extremes Identifies CAV2 and TMC6 as Interacting Modifiers of Chronic Pseudomonas aeruginosa Infection in Cystic Fibrosis.
25378492 2015 Expression of the epidermodysplasia verruciformis-associated genes EVER1 and EVER2 is activated by exogenous DNA and inhibited by LMP1 oncoprotein from Epstein-Barr virus.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23535066 Merkel cell polyomavirus detection in a patient with familial epidermodysplasia verruciformis.
23534907 Epidermodysplasia verruciformis in lipoid proteinosis: case report and discussion of pathophysiology.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22761942 2012 EVER proteins, key elements of the natural anti-human papillomavirus barrier, are regulated upon T-cell activation.
More...