Property Summary

NCBI Gene PubMed Count 26
PubMed Score 151.53
PubTator Score 50.41

Knowledge Summary

Patent (5,150)

Expression

  Differential Expression (6)

Disease log2 FC p
active ulcerative colitis 1.081 9.9e-03
gastric carcinoma 1.200 8.2e-03
group 3 medulloblastoma -1.100 2.8e-02
intraductal papillary-mucinous neoplasm ... 1.100 9.8e-03
malignant mesothelioma 2.900 9.3e-07
osteosarcoma -2.356 4.9e-05

Protein-protein Interaction (2)

Gene RIF (17)

AA Sequence

MAQPLAFILDVPETPGDQGQGPSPYDESEVHDSFQQLIQEQSQCTAQEGLELQQREREVTGSSQQTLWRP      1 - 70
EGTQSTATLRILASMPSRTIGRSRGAIISQYYNRTVQLRCRSSRPLLGNFVRSAWPSLRLYDLELDPTAL     71 - 140
EEEEKQSLLVKELQSLAVAQRDHMLRGMPLSLAEKRSLREKSRTPRGKWRGQPGSGGVCSCCGRLRYACV    141 - 210
LALHSLGLALLSALQALMPWRYALKRIGGQFGSSVLSYFLFLKTLLAFNALLLLLLVAFIMGPQVAFPPA    211 - 280
LPGPAPVCTGLELLTGAGCFTHTVMYYGHYSNATLNQPCGSPLDGSQCTPRVGGLPYNMPLAYLSTVGVS    281 - 350
FFITCITLVYSMAHSFGESYRVGSTSGIHAITVFCSWDYKVTQKRASRLQQDNIRTRLKELLAEWQLRHS    351 - 420
PRSVCGRLRQAAVLGLVWLLCLGTALGCAVAVHVFSEFMIQSPEAAGQEAVLLVLPLVVGLLNLGAPYLC    421 - 490
RVLAALEPHDSPVLEVYVAICRNLILKLAILGTLCYHWLGRRVGVLQGQCWEDFVGQELYRFLVMDFVLM    491 - 560
LLDTLFGELVWRIISEKKLKRRRKPEFDIARNVLELIYGQTLTWLGVLFSPLLPAVQIIKLLLVFYVKKT    561 - 630
SLLANCQAPRRPWLASHMSTVFLTLLCFPAFLGAAVFLCYAVWQVKPSSTCGPFRTLDTMYEAGRVWVRH    631 - 700
LEAAGPRVSWLPWVHRYLMENTFFVFLVSALLLAVIYLNIQVVRGQRKVICLLKEQISNEGEDKIFLINK    701 - 770
LHSIYERKEREERSRVGTTEEAAAPPALLTDEQDA                                       771 - 805
//

Text Mined References (28)

PMID Year Title