Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.47
PubTator Score 0.32

Knowledge Summary

Patent (420)

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4740 1.4e-03
interstitial cystitis 2312 5.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Essential Hypertension 94 0.0 0.9

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -1.100 5.7e-03
lung cancer -1.100 1.4e-03

AA Sequence

MSESSGSALQPGRPSRQPAVHPENLSLDSSCFSSPPVNFLQELPSYRSIARRRTTVHSRDKQSGTLLKPT      1 - 70
DSYSSQLEDRIAENLSSHSLRNYALNISEKRRLRDIQETQMKYLSEWDQWKRYSSKSWKRFLEKAREMTT     71 - 140
HLELWREDIRSIEGKFGTGIQSYFSFLRFLVLLNLVIFLIIFMLVLLPVLLTKYKITNSSFVLIPFKDMD    141 - 210
KQCTVYPVSSSGLIYFYSYIIDLLSGTGFLEETSLFYGHYTIDGVKFQNFTYDLPLAYLLSTIASLALSL    211 - 280
LWIVKRSVEGFKINLIRSEEHFQSYCNKIFAGWDFCITNRSMADLKHSSLRYELRADLEEERMRQKIAER    281 - 350
TSEETIRIYSLRLFLNCIVLAVLGACFYAIYVATVFSQEHMKKEIDKMVFGENLFILYLPSIVITLANFI    351 - 420
TPMIFAKIIRYEDYSPGFEIRLTILRCVFMRLATICVLVFTLGSKITSCDDDTCDLCGYNQKLYPCWETQ    421 - 490
VGQEMYKLMIFDFIIILAVTLFVDFPRKLLVTYCSSCKLIQCWGQQEFAIPDNVLGIVYGQTICWIGAFF    491 - 560
SPLLPAIATLKFIIIFYVKEWSLLYTCRPSPRPFRASNSNFFFLLVLLIGLCLAIIPLTISISRIPSSKA    561 - 630
CGPFTNFNTTWEVIPKTVSTFPSSLQSFIHGVTSEAFAVPFFMIICLIMFYFIALAGAHKRVVIQLREQL    631 - 700
SLESRDKCYLIQKLTEAQRDMRN                                                   701 - 723
//

Text Mined References (10)

PMID Year Title