Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.33
PubTator Score 8.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
ovarian cancer 8492 1.27530658083829E-9
tuberculosis 1563 1.64197913735534E-7
osteosarcoma 7933 1.31825314845993E-5
atypical teratoid / rhabdoid tumor 4369 4.05205185654826E-4
Atopic dermatitis 944 4.85657032920752E-4
lung cancer 4473 0.0050560201035397
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00602888065542226
aldosterone-producing adenoma 664 0.0222841055590279
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Peripheral vascular disease 90 0.0 2.0

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -2.044 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
Atopic dermatitis 1.100 0.000
tuberculosis -1.800 0.000
intraductal papillary-mucinous carcinoma... -1.300 0.006
lung cancer -1.100 0.005
aldosterone-producing adenoma -1.267 0.022
ovarian cancer -1.300 0.000

Synonym

Accession Q7Z401 E7EPL3 Q14655 Q86T77 Q8IVX2 Q8NB93
Symbols IRLB
MYCPBP

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

AA Sequence

MIEDKGPRVADYFVVAGLTDVSKPLEEEIHFNDACHKVAKPKEPITDVSVIIKSLGEEVPQDYICIDVTP      1 - 70
TGLSADLNNGSLVGPQIYLCYRRGRDKPPLTDLGVLYDWKERLKQGCEIIQSTPYGRPANISGSTSSQRI     71 - 140
YITYRRASENMTQNTLAVTDICIIIPSKGESPPHTFCKVDKNLNNSMWGSAVYLCYKKSVAKTNTVSYKA    141 - 210
GLICRYPQEDYESFSLPESVPLFCLPMGATIECWPSNSKYPLPVFSTFVLTGASAEKVYGAAIQFYEPYS    211 - 280
EENLTEKQRLLLGLTSADGKSDSSKTIHTNKCICLLSHWPFFDAFRKFLTFLYRYSISGPHVLPIEKHIS    281 - 350
HFMHKVPFPSPQRPRILVQLSPHDNLILSQPVSSPLPLSGGKFSTLLQNLGPENAVTLLVFAVTEHKILI    351 - 420
HSLRPSVLTSVTEALVSMIFPFHWPCPYVPLCPLALADVLSAPCPFIVGIDSRYFDLYDPPPDVSCVDVD    421 - 490
TNTISQIGDKKNVAWKILPKKPCKNLMNTLNNLHQQLAKLQQRPRDDGLMDLAINDYDFNSGKRLHMIDL    491 - 560
EIQEAFLFFMASILKGYRSYLRPITQAPSETATDAASLFALQAFLRSRDRSHQKFYNMMTKTQMFIRFIE    561 - 630
ECSFVSDKDASLAFFDDCVDKVDMDKSGEVRLIELDESFKSEHTVFVTPPEIPHLPNGEEPPLQYSYNGF    631 - 700
PVLRNNLFERPEGFLQAKKNKLPSKSSSPNSPLPMFRRTKQEIKSAHKIAKRYSSIPQMWSRCLLRHCYG    701 - 770
LWFICLPAYVKVCHSKVRALKTAYDVLKKMQSKKMDPPDEVCYRILMQLCGQYDQPVLAVRVLFEMQKAG    771 - 840
IDPNAITYGYYNKAVLESTWPSRSRSGYFLWTKVRNVVLGVTQFKRALKKHAHLSQTTLSGGQSDLGYNS    841 - 910
LSKDEVRRGDTSTEDIQEEKDKKGSDCSSLSESESTKGSADCLPKLSYQNSSSIVRLTGTSNNSAGKISG    911 - 980
ESMESTPELLLISSLEDTNETRNIQSRCFRKRHKSDNETNLQQQVVWGNRNRNLSGGVLMGFMLNRINQE    981 - 1050
ATPGDIVEKLGADAKILSNVISKSTRPNTLDIGKPPLRSKRDSLEKESSDDDTPFDGSNYLADKVDSPVI   1051 - 1120
FDLEDLDSETDVSKAGCVATQNPKRIQRMNSSFSVKPFEKTDVATGFDPLSLLVAETEQQQKEEEEEDED   1121 - 1190
DSKSISTPSARRDLAEEIVMYMNNMSSPLTSRTPSIDLQRACDDKLNKKSPPLVKACRRSSLPPNSPKPV   1191 - 1260
RLTKSKSYTKSEEKPRDRLWSSPAFSPTCPFREESQDTLTHSSPSFNLDTLLVPKLDVLRNSMFTAGKGV   1261 - 1330
AEKASKWYSRFTMYTTSSKDQSSDRTSLSSVGAQDSESTSLTDEDVCHELEGPISSQETSATSGTKRIDL   1331 - 1400
SRISLESSASLEGSLSKFALPGKSEVTSSFNASNTNIFQNYAMEVLISSCSRCRTCDCLVHDEEIMAGWT   1401 - 1470
ADDSNLNTTCPFCGNIFLPFLNIEIRDLRRPGRYFLKSSPSTENMHFPSSISSQTRQSCISTSASGLDTS   1471 - 1540
ALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSL   1541 - 1610
PATLQGATDSLGLEWHLPSPDPVTVPYLSPLVVWKELESLLENEGDHAITVADFVDHHPIVFWNLVWYFR   1611 - 1680
RLDLPSNLPGLILSSEHCNKYSKIPRHCMSEDSKYVLIQMLWDNMKLHQDPGQPLYILWNAHTQKYPMVH   1681 - 1750
LLQKSDNSFNQELLKSMVKSIKMNDVYGPMSQILETLNKCPHFKRQRSLYREILFLSLVALGRENIDIDA   1751 - 1820
FDKEYKMAYDRLTPSQVKSTHNCDRPPSTGVMECRKTFGEPYL                              1821 - 1863
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...