Property Summary

NCBI Gene PubMed Count 12
PubMed Score 88.96
PubTator Score 44.16

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 3.000 1.2e-04
medulloblastoma, large-cell 3.300 1.8e-04
pituitary cancer 1.700 2.5e-03

Synonym

Accession Q7Z3Z2 A8K595
Symbols LCA12
C1orf36

Gene

RD3

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MSLISWLRWNEAPSRLSTRSPAEMVLETLMMELTGQMREAERQQRERSNAVRKVCTGVDYSWLASTPRST      1 - 70
YDLSPIERLQLEDVCVKIHPSYCGPAILRFRQLLAEQEPEVQEVSQLFRSVLQEVLERMKQEEEAHKLTR     71 - 140
QWSLRPRGSLATFKTRARISPFASDIRTISEDVERDTPPPLRSWSMPEFRAPKAD                   141 - 195
//

Text Mined References (12)

PMID Year Title