Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.65
PubTator Score 28.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Woolly Hair, Autosomal Recessive 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Hypotrichosis 47 0.0 4.0
Disease Target Count Z-score Confidence
Hair disease 1 4.519 2.3

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.700 1.5e-02

Gene RIF (2)

AA Sequence

MSLRLSSASRRSCPRPTTGSLRLYGGGTSFGTGNSCGISGIGSGFSSAFGGSSSGGNTGGGNPCAGFTVN      1 - 70
ERGLLSGNEKVTMQNLNDRLASYLDSVHALEEANADLEQKIKGWYEKFGPGSCRGLDHDYSRYFPIIDDL     71 - 140
KNQIIASTTSNANAVLQIDNARLTADDFRLKYENELALHQSVEADVNGLRRVLDEITLCRTDLEIQYETL    141 - 210
SEEMTYLKKNHKEEMQVLQCAAGGNVNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSAS    211 - 280
LQQQISEDVGATTSARNELTEMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEE    281 - 350
QLHQVRTETEGQKLEYEQLLDIKLHLEKEIETYCLLIGGDDGACKSGGYKSKDYGSGNVGSQVKDPAKAI    351 - 420
VVKKVLEEVDQRSKILTTRLHSLEEKSQSN                                            421 - 450
//

Text Mined References (11)

PMID Year Title