Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.37
PubTator Score 28.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.700 0.015

Synonym

Accession Q7Z3Z0
Symbols ARWH3
KRT25A
KRT24IRS1

Gene

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSLRLSSASRRSCPRPTTGSLRLYGGGTSFGTGNSCGISGIGSGFSSAFGGSSSGGNTGGGNPCAGFTVN      1 - 70
ERGLLSGNEKVTMQNLNDRLASYLDSVHALEEANADLEQKIKGWYEKFGPGSCRGLDHDYSRYFPIIDDL     71 - 140
KNQIIASTTSNANAVLQIDNARLTADDFRLKYENELALHQSVEADVNGLRRVLDEITLCRTDLEIQYETL    141 - 210
SEEMTYLKKNHKEEMQVLQCAAGGNVNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSAS    211 - 280
LQQQISEDVGATTSARNELTEMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEE    281 - 350
QLHQVRTETEGQKLEYEQLLDIKLHLEKEIETYCLLIGGDDGACKSGGYKSKDYGSGNVGSQVKDPAKAI    351 - 420
VVKKVLEEVDQRSKILTTRLHSLEEKSQSN                                            421 - 450
//

Text Mined References (10)

PMID Year Title
26902920 2016 Autosomal Recessive Hypotrichosis with Woolly Hair Caused by a Mutation in the Keratin 25 Gene Expressed in Hair Follicles.
26160856 2015 A homozygous missense variant in type I keratin KRT25 causes autosomal recessive woolly hair.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21916889 2011 Hair greying is associated with active hair growth.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16874310 2006 K25 (K25irs1), K26 (K25irs2), K27 (K25irs3), and K28 (K25irs4) represent the type I inner root sheath keratins of the human hair follicle.
16831889 2006 New consensus nomenclature for mammalian keratins.
15617563 2004 The human type I keratin gene family: characterization of new hair follicle specific members and evaluation of the chromosome 17q21.2 gene domain.
15085952 2004 Comprehensive analysis of keratin gene clusters in humans and rodents.