Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.25
PubTator Score 4.08

Knowledge Summary

Patent (259)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -3.543 0.000
ependymoma -1.100 0.000
diabetes mellitus 1.300 0.002
group 3 medulloblastoma 1.500 0.029

Gene RIF (3)

PMID Text
25847845 OR2W3 is associated with genetic susceptibility to Japanese male infertility.
25783483 A novel missense mutation, c. 424 C > T transition (p.R142W) in OR2W3 gene, was identified as a potentially causative mutation for autosomal dominant Retinitis pigmentosa.
25374392 Our results provided a new insight into susceptibility of USF1 variant with male infertility. rs11204546 of OR2W3 and rs11677854 of GTF2A1L might be additional valuable molecular predictive markers

AA Sequence

MDGTNGSTQTHFILLGFSDRPHLERILFVVILIAYLLTLVGNTTIILVSRLDPHLHTPMYFFLAHLSFLD      1 - 70
LSFTTSSIPQLLYNLNGCDKTISYMGCAIQLFLFLGLGGVECLLLAVMAYDRCVAICKPLHYMVIMNPRL     71 - 140
CRGLVSVTWGCGVANSLAMSPVTLRLPRCGHHEVDHFLREMPALIRMACVSTVAIEGTVFVLAVGVVLSP    141 - 210
LVFILLSYSYIVRAVLQIRSASGRQKAFGTCGSHLTVVSLFYGNIIYMYMQPGASSSQDQGMFLMLFYNI    211 - 280
VTPLLNPLIYTLRNREVKGALGRLLLGKRELGKE                                        281 - 314
//

Text Mined References (9)

PMID Year Title
25847845 2015 Susceptibility to male infertility: replication study in Japanese men looking for an association with four GWAS-derived loci identified in European men.
25825126 2015 Accumulation of rare variants in the arylsulfatase G (ARSG) gene in task-specific dystonia.
25783483 2015 Whole-exome sequencing identifies OR2W3 mutation as a cause of autosomal dominant retinitis pigmentosa.
25374392 2015 Association of single nucleotide polymorphisms in the USF1, GTF2A1L and OR2W3 genes with non-obstructive azoospermia in the Chinese population.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.