Property Summary

NCBI Gene PubMed Count 9
PubMed Score 44.10
PubTator Score 7.39

Knowledge Summary

Patent (4,078)

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease -1.045 2.7e-02
adult high grade glioma 1.500 6.4e-04
atypical teratoid / rhabdoid tumor 1.200 3.1e-03
glioblastoma 1.300 2.4e-04
medulloblastoma 1.400 5.0e-02
medulloblastoma, large-cell 2.900 3.9e-06
osteosarcoma -1.409 5.4e-03
pituitary cancer 2.400 1.2e-06

 MGI Phenotype (1)

Gene RIF (4)

AA Sequence

MVCGCSALLPLPNPRPTMPATPNFLANPSSSSRWIPLQPMPVAWAFVQKTSALLWLLLLGTSLSPAWGQA      1 - 70
KIPLETVKLWADTFGGDLYNTVTKYSGSLLLQKKYKDVESSLKIEEVDGLELVRKFSEDMENMLRRKVEA     71 - 140
VQNLVEAAEEADLNHEFNESLVFDYYNSVLINERDEKGNFVELGAEFLLESNAHFSNLPVNTSISSVQLP    141 - 210
TNVYNKDPDILNGVYMSEALNAVFVENFQRDPTLTWQYFGSATGFFRIYPGIKWTPDENGVITFDCRNRG    211 - 280
WYIQAATSPKDIVILVDVSGSMKGLRMTIAKHTITTILDTLGENDFINIIAYNDYVHYIEPCFKGILVQA    281 - 350
DRDNREHFKLLVEELMVKGVGVVDQALREAFQILKQFQEAKQGSLCNQAIMLISDGAVEDYEPVFEKYNW    351 - 420
PDCKVRVFTYLIGREVSFADRMKWIACNNKGYYTQISTLADTQENVMEYLHVLSRPMVINHDHDIIWTEA    421 - 490
YMDSKLLSSQAQSLTLLTTVAMPVFSKKNETRSHGILLGVVGSDVALRELMKLAPRYKLGVHGYAFLNTN    491 - 560
NGYILSHPDLRPLYREGKKLKPKPNYNSVDLSEVEWEDQAESLRTAMINRETGTLSMDVKVPMDKGKRVL    561 - 630
FLTNDYFFTDISDTPFSLGVVLSRGHGEYILLGNTSVEEGLHDLLHPDLALAGDWIYCITDIDPDHRKLS    631 - 700
QLEAMIRFLTRKDPDLECDEELVREVLFDAVVTAPMEAYWTALALNMSEESEHVVDMAFLGTRAGLLRSS    701 - 770
LFVGSEKVSDRKFLTPEDEASVFTLDRFPLWYRQASEHPAGSFVFNLRWAEGPESAGEPMVVTASTAVAV    771 - 840
TVDKRTAIAAAAGVQMKLEFLQRKFWAATRQCSTVDGPCTQSCEDSDLDCFVIDNNGFILISKRSRETGR    841 - 910
FLGEVDGAVLTQLLSMGVFSQVTMYDYQAMCKPSSHHHSAAQPLVSPISAFLTATRWLLQELVLFLLEWS    911 - 980
VWGSWYDRGAEAKSVFHHSHKHKKQDPLQPCDTEYPVFVYQPAIREANGIVECGPCQKVFVVQQIPNSNL    981 - 1050
LLLVTDPTCDCSIFPPVLQEATEVKYNASVKCDRMRSQKLRRRPDSCHAFHPEENAQDCGGASDTSASPP   1051 - 1120
LLLLPVCAWGLLPQLLR                                                        1121 - 1137
//

Text Mined References (12)

PMID Year Title