Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.33
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
cystic fibrosis -1.455 4.0e-05
esophageal adenocarcinoma 1.400 2.9e-02
group 3 medulloblastoma -1.700 4.5e-03
interstitial cystitis 1.400 1.8e-03
lung cancer -2.000 8.4e-03
malignant mesothelioma 1.900 2.6e-07
medulloblastoma, large-cell -2.100 7.8e-05
non-small cell lung cancer -1.176 1.8e-10
osteosarcoma -1.812 6.7e-04
ovarian cancer -2.800 5.3e-15
psoriasis -1.800 1.1e-08

Gene RIF (1)

AA Sequence

MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQKKVS      1 - 70
RFNLQMDISGLIPGLVSTFILLSISDHYGRKFPMILSSVGALATSVWLCLLCYFAFPFQLLIASTFIGAF     71 - 140
CGNYTTFWGACFAYIVDQCKEHKQKTIRIAIIDFLLGLVTGLTGLSSGYFIRELGFEWSFLIIAVSLAVN    141 - 210
LIYILFFLGDPVKECSSQNVTMSCSEGFKNLFYRTYMLFKNASGKRRFLLCLLLFTVITYFFVVIGIAPI    211 - 280
FILYELDSPLCWNEVFIGYGSALGSASFLTSFLGIWLFSYCMEDIHMAFIGIFTTMTGMAMTAFASTTLM    281 - 350
MFLARVPFLFTIVPFSVLRSMLSKVVRSTEQGTLFACIAFLETLGGVTAVSTFNGIYSATVAWYPGFTFL    351 - 420
LSAGLLLLPAISLCVVKCTSWNEGSYELLIQEESSEDASDR                                 421 - 461
//

Text Mined References (12)

PMID Year Title