Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.33
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
esophageal adenocarcinoma 1.400 0.029
psoriasis -1.800 0.000
osteosarcoma -1.812 0.001
group 3 medulloblastoma -1.700 0.005
cystic fibrosis -1.455 0.000
medulloblastoma, large-cell -2.100 0.000
non-small cell lung cancer -1.176 0.000
lung cancer -2.000 0.008
interstitial cystitis 1.600 0.000
ovarian cancer -2.800 0.000

Gene RIF (1)

PMID Text
26631267 our results establish SLC46A3 as a direct transporter of maytansine-based catabolites from the lysosome to the cytoplasm

AA Sequence

MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQKKVS      1 - 70
RFNLQMDISGLIPGLVSTFILLSISDHYGRKFPMILSSVGALATSVWLCLLCYFAFPFQLLIASTFIGAF     71 - 140
CGNYTTFWGACFAYIVDQCKEHKQKTIRIAIIDFLLGLVTGLTGLSSGYFIRELGFEWSFLIIAVSLAVN    141 - 210
LIYILFFLGDPVKECSSQNVTMSCSEGFKNLFYRTYMLFKNASGKRRFLLCLLLFTVITYFFVVIGIAPI    211 - 280
FILYELDSPLCWNEVFIGYGSALGSASFLTSFLGIWLFSYCMEDIHMAFIGIFTTMTGMAMTAFASTTLM    281 - 350
MFLARVPFLFTIVPFSVLRSMLSKVVRSTEQGTLFACIAFLETLGGVTAVSTFNGIYSATVAWYPGFTFL    351 - 420
LSAGLLLLPAISLCVVKCTSWNEGSYELLIQEESSEDASDR                                 421 - 461
//

Text Mined References (12)

PMID Year Title
26631267 2015 SLC46A3 Is Required to Transport Catabolites of Noncleavable Antibody Maytansine Conjugates from the Lysosome to the Cytoplasm.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20708005 2010 Genome-wide association study identifies variants associated with histologic features of nonalcoholic Fatty liver disease.
19284880 2009 Identification of candidate genes for human pituitary development by EST analysis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...