Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.97
PubTator Score 0.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease -1.181 3.0e-02
active ulcerative colitis -1.090 4.0e-02
group 3 medulloblastoma 1.400 1.2e-02
medulloblastoma, large-cell 1.400 1.4e-04
osteosarcoma 1.906 1.3e-04
ovarian cancer -1.300 2.2e-04
primitive neuroectodermal tumor 1.200 2.9e-04
tuberculosis and treatment for 6 months 1.200 7.1e-05

Gene RIF (2)

AA Sequence

MAEASFGSSSPVGSLSSEDHDFDPTAEMLVHDYDDERTLEEEEMMDEGKNFSSEIEDLEKEGTMPLEDLL      1 - 70
AFYGYEPTIPAVANSSANSSPSELADELPDMTLDKEEIAKDLLSGDDEETQSSADDLTPSVTSHETSDFF     71 - 140
PRPLRSNTACDGDKESEVEDVETDSGNSPEDLRKEIMIGLQYQAEIPPYLGEYDGNEKVYENEDQLLWCP    141 - 210
DVVLESKVKEYLVETSLRTGSEKIMDRISAGTHTRDNEQALYELLKCNHNIKEAIERYCCNGKASQEGMT    211 - 280
AWTEEECRSFEHALMLFGKDFHLIQKNKVRTRTVAECVAFYYMWKKSERYDYFAQQTRFGKKRYNHHPGV    281 - 350
TDYMDRLVDETEALGGTVNASALTSNRPEPIPDQQLNILNSFTASDLTALTNSVATVCDPTDVNCLDDSF    351 - 420
PPLGNTPRGQVNHVPVVTEELLTLPSNGESDCFNLFETGFYHSELNPMNMCSEESERPAKRLKMGIAVPE    421 - 490
SFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFGSLSANETNGFISAHALHQHAALHSE              491 - 550
//

Text Mined References (17)

PMID Year Title