Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.26
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
23565263 Data have identified a novel retinal SAM domain protein, Samd7, which could act as a transcriptional repressor involved in fine-tuning of Crx-regulated gene expression.

AA Sequence

MAVNPLLTPTGQQTIPLIPSPFGPPTVDRDVLPSTVAPTDPRQFCVPSQFGSSVLPNTNMANVLSSRIYP      1 - 70
GWGILPPESIKAVARRNEMIQRHHTARTEMEMYAIYQQRRMEKINPKGLAGLGIPFLYGSSVPAAPAAYH     71 - 140
GRSMLPAGDLHFHRSTLRNLQGNPMLAATAPHFEESWGQRCRRLRKNTGNQKALDSDAESSKSQAEEKIL    141 - 210
GQTHAVPYEEDHYAKDPDIEAPSNQKSSETNEKPTTALANTCGELEPTHRKPWGSHTTTLKAKAWDDGKE    211 - 280
EASEQIFATCDEKNGVCPPVPRPSLPGTHALVTIGGNLSLDEDIQKWTVDDVHSFIRSLPGCSDYAQVFK    281 - 350
DHAIDGETLPLLTEEHLRGTMGLKLGPALKIQSQVSQHVGSMFYKKTLSFPIRQAFDQPADTSPLLDPNS    351 - 420
WSDTMNIFCPQDTIIPKGIERGSMRN                                                421 - 446
//

Text Mined References (4)

PMID Year Title
23565263 2013 Sterile alpha motif containing 7 (samd7) is a novel crx-regulated transcriptional repressor in the retina.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.