Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.23
PubTator Score 0.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease 1.596 5.4e-03
adult high grade glioma -1.200 6.2e-03
aldosterone-producing adenoma -1.253 2.3e-02
Alzheimer's disease 1.500 4.8e-02
astrocytic glioma -2.100 5.3e-03
atypical teratoid / rhabdoid tumor -3.300 5.0e-08
chronic rhinosinusitis -1.589 2.0e-02
ependymoma -2.700 4.4e-02
gastric cancer 1.100 1.6e-03
glioblastoma -1.800 1.8e-04
head and neck cancer -1.100 2.8e-02
Hydrolethalus syndrome 1.539 4.9e-02
interstitial cystitis 1.400 1.0e-02
intraductal papillary-mucinous adenoma (... -1.800 1.1e-04
intraductal papillary-mucinous neoplasm ... -1.800 1.8e-03
medulloblastoma -1.400 1.8e-02
medulloblastoma, large-cell -2.100 3.7e-04
mucosa-associated lymphoid tissue lympho... 1.597 4.8e-02
osteosarcoma -1.565 2.2e-02
ovarian cancer -1.400 4.1e-08
pancreatic cancer -1.100 1.0e-04
Pick disease -1.600 6.0e-03
primitive neuroectodermal tumor -1.800 3.8e-04
progressive supranuclear palsy 1.600 7.8e-03
sarcoidosis 1.100 2.6e-02
tuberculosis 1.200 6.1e-03

Gene RIF (1)

AA Sequence

MNSNLPAENLTIAVNMTKTLPTAVTHGFNSTNDPPSMSITRLFPALLECFGIVLCGYIAGRANVITSTQA      1 - 70
KGLGNFVSRFALPALLFKNMVVLNFSNVDWSFLYSILIAKASVFFIVCVLTLLVASPDSRFSKAGLFPIF     71 - 140
ATQSNDFALGYPIVEALYQTTYPEYLQYIYLVAPISLMMLNPIGFIFCEIQKWKDTQNASQNKIKIVGLG    141 - 210
LLRVLQNPIVFMVFIGIAFNFILDRKVPVYVENFLDGLGNSFSGSALFYLGLTMVGKIKRLKKSAFVVLI    211 - 280
LLITAKLLVLPLLCREMVELLDKGDSVVNHTSLSNYAFLYGVFPVAPGVAIFATQFNMEVEIITSGMVIS    281 - 350
TFVSAPIMYVSAWLLTFPTMDPKPLAYAIQNVSFDISIVSLISLIWSLAILLLSKKYKQLPHMLTTNLLI    351 - 420
AQSIVCAGMMIWNFVKEKNFVGQILVFVLLYSSLYSTYLWTGLLAISLFLLKKRERVQIPVGIIIISGWG    421 - 490
IPALLVGVLLITGKHNGDSIDSAFFYGKEQMITTAVTLFCSILIAGISLMCMNQTAQAGSYEGFDQSQSH    491 - 560
KVVEPGNTAFEESPAPVNEPELFTSSIPETSCCSCSMGNGELHCPSIEPIANTSTSEPVIPSFEKNNHCV    561 - 630
SRCNSQSCILAQEEEQYLQSGDQQLTRHVLLCLLLIIGLFANLSSCLWWLFNQEPGRLYVELQFFCAVFN    631 - 700
FGQGFISFGIFGLDKHLIILPFKRRLEFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKER    701 - 770
RCGAKTSAGTFCGCDLVSWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEFRDEYLFYRFLQKSPEQ    771 - 840
SPPAINANTLQQERYKEIEHSSPPSHSPKT                                            841 - 870
//

Text Mined References (14)

PMID Year Title