Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.73
PubTator Score 0.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Autistic Disorder 320
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 4.97144471203024E-8
sonic hedgehog group medulloblastoma 1482 1.11230211176284E-5
ovarian cancer 8492 9.47784767960498E-5
pancreatic cancer 2300 1.01483420286875E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 1.13690003238523E-4
glioblastoma 5572 1.83413078107018E-4
medulloblastoma, large-cell 6234 3.74876838738454E-4
primitive neuroectodermal tumor 3031 3.82554537980431E-4
pediatric high grade glioma 2712 8.03073491377387E-4
Pick disease 1893 0.00159154862827652
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00176426343940364
astrocytic glioma 2241 0.00534894002961573
active Crohn's disease 918 0.00539853122814227
tuberculosis 1563 0.00612045062415717
progressive supranuclear palsy 674 0.00776541683119767
interstitial cystitis 2299 0.0101136525610988
chronic rhinosinusitis 512 0.0199622475937918
osteosarcoma 7933 0.0217903329986329
aldosterone-producing adenoma 664 0.022997905779596
sarcoidosis 368 0.0261000679944372
head and neck cancer 270 0.0282204892002073
gastric carcinoma 832 0.036320068250996
ependymoma 2514 0.0436985014340463
mucosa-associated lymphoid tissue lymphoma 480 0.0480688134320144
Alzheimer's disease 644 0.0484288734305045
Hydrolethalus syndrome 128 0.0491523828186899
Disease Target Count Z-score Confidence
Follicular adenoma 8 3.008 1.5

Expression

Synonym

Accession Q7Z3F1 B2RCI2 D3DPE2 Q4G0Y6 Q53SJ3 Q53TA8 Q69YG8 Q86SP9 Q8N261 Q8N639 Q8N8K3 Q96MV6
Symbols DEP.7
PGR22
DEPDC3

Gene

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
Zebrafish OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNSNLPAENLTIAVNMTKTLPTAVTHGFNSTNDPPSMSITRLFPALLECFGIVLCGYIAGRANVITSTQA      1 - 70
KGLGNFVSRFALPALLFKNMVVLNFSNVDWSFLYSILIAKASVFFIVCVLTLLVASPDSRFSKAGLFPIF     71 - 140
ATQSNDFALGYPIVEALYQTTYPEYLQYIYLVAPISLMMLNPIGFIFCEIQKWKDTQNASQNKIKIVGLG    141 - 210
LLRVLQNPIVFMVFIGIAFNFILDRKVPVYVENFLDGLGNSFSGSALFYLGLTMVGKIKRLKKSAFVVLI    211 - 280
LLITAKLLVLPLLCREMVELLDKGDSVVNHTSLSNYAFLYGVFPVAPGVAIFATQFNMEVEIITSGMVIS    281 - 350
TFVSAPIMYVSAWLLTFPTMDPKPLAYAIQNVSFDISIVSLISLIWSLAILLLSKKYKQLPHMLTTNLLI    351 - 420
AQSIVCAGMMIWNFVKEKNFVGQILVFVLLYSSLYSTYLWTGLLAISLFLLKKRERVQIPVGIIIISGWG    421 - 490
IPALLVGVLLITGKHNGDSIDSAFFYGKEQMITTAVTLFCSILIAGISLMCMNQTAQAGSYEGFDQSQSH    491 - 560
KVVEPGNTAFEESPAPVNEPELFTSSIPETSCCSCSMGNGELHCPSIEPIANTSTSEPVIPSFEKNNHCV    561 - 630
SRCNSQSCILAQEEEQYLQSGDQQLTRHVLLCLLLIIGLFANLSSCLWWLFNQEPGRLYVELQFFCAVFN    631 - 700
FGQGFISFGIFGLDKHLIILPFKRRLEFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKER    701 - 770
RCGAKTSAGTFCGCDLVSWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEFRDEYLFYRFLQKSPEQ    771 - 840
SPPAINANTLQQERYKEIEHSSPPSHSPKT                                            841 - 870
//

Text Mined References (14)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17519220 2007 Genome-wide expression profiling of lymphoblastoid cell lines distinguishes different forms of autism and reveals shared pathways.
16381901 2006 The LIFEdb database in 2006.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...