Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.136 1.6e-02
adult high grade glioma -1.500 4.3e-03
astrocytic glioma -1.300 3.2e-02
atypical teratoid / rhabdoid tumor -1.300 9.7e-05
Breast cancer -1.100 3.2e-11
glioblastoma -1.600 2.4e-04
intraductal papillary-mucinous neoplasm ... -1.600 5.4e-03
medulloblastoma -1.100 3.9e-03
medulloblastoma, large-cell -1.400 3.0e-02
osteosarcoma -1.152 6.0e-04
ovarian cancer -1.300 1.2e-04
psoriasis -1.500 8.1e-07
Rheumatoid arthritis 1.400 1.8e-02
ulcerative colitis 1.100 7.2e-03

 Compartment GO Term (1)

AA Sequence

MSETDHIASTSSDKNVGKTPELKEDSCNLFSGNESSKLENESKLLSLNTDKTLCQPNEHNNRIEAQENYI      1 - 70
PDHGGGEDSCAKTDTGSENSEQIANFPSGNFAKHISKTNETEQKVTQILVELRSSTFPESANEKTYSESP     71 - 140
YDTDCTKKFISKIKSVSASEDLLEEIESELLSTEFAEHRVPNGMNKGEHALVLFEKCVQDKYLQQEHIIK    141 - 210
KLIKENKKHQELFVDICSEKDNLREELKKRTETEKQHMNTIKQLESRIEELNKEVKASRDQLIAQDVTAK    211 - 280
NAVQQLHKEMAQRMEQANKKCEEARQEKEAMVMKYVRGEKESLDLRKEKETLEKKLRDANKELEKNTNKI    281 - 350
KQLSQEKGRLHQLYETKEGETTRLIREIDKLKEDINSHVIKVKWAQNKLKAEMDSHKETKDKLKETTTKL    351 - 420
TQAKEEADQIRKNCQDMIKTYQESEEIKSNELDAKLRVTKGELEKQMQEKSDQLEMHHAKIKELEDLKRT    421 - 490
FKEGMDELRTLRTKVKCLEDERLRTEDELSKYKEIINRQKAEIQNLLDKVKTADQLQEQLQRGKQEIENL    491 - 560
KEEVESLNSLINDLQKDIEGSRKRESELLLFTERLTSKNAQLQSESNSLQSQFDKVSCSESQLQSQCEQM    561 - 630
KQTNINLESRLLKEEELRKEEVQTLQAELACRQTEVKALSTQVEELKDELVTQRRKHASSIKDLTKQLQQ    631 - 700
ARRKLDQVESGSYDKEVSSMGSRSSSSGSLNARSSAEDRSPENTGSSVAVDNFPQVDKAMLIERIVRLQK    701 - 770
AHARKNEKIEFMEDHIKQLVEEIRKKTKIIQSYILREESGTLSSEASDFNKVHLSRRGGIMASLYTSHPA    771 - 840
DNGLTLELSLEINRKLQAVLEDTLLKNITLKENLQTLGTEIERLIKHQHELEQRTKKT                841 - 898
//

Text Mined References (13)

PMID Year Title