Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 3.16355545651021E-11
psoriasis 6685 8.10622474164688E-7
ovarian cancer 8492 1.20979961733055E-4
glioblastoma 5572 2.44699179685787E-4
osteosarcoma 7933 5.99773914842694E-4
atypical teratoid / rhabdoid tumor 4369 0.00164144755851832
adult high grade glioma 2148 0.00428551181308976
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0053622377049057
medulloblastoma 1524 0.00670441257349751
ulcerative colitis 2087 0.00718542211319245
medulloblastoma, large-cell 6234 0.00735377063874324
active Crohn's disease 918 0.015563334250685
Rheumatoid Arthritis 1171 0.0184659251553201
astrocytic glioma 2241 0.0320480689959728

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.018
astrocytic glioma -1.300 0.032
glioblastoma -1.600 0.000
osteosarcoma -1.152 0.001
atypical teratoid / rhabdoid tumor -1.400 0.002
medulloblastoma -1.300 0.007
medulloblastoma, large-cell -1.500 0.007
intraductal papillary-mucinous neoplasm ... -1.600 0.005
active Crohn's disease 1.136 0.016
adult high grade glioma -1.500 0.004
psoriasis -1.500 0.000
Breast cancer -1.100 0.000
ulcerative colitis 1.100 0.007
ovarian cancer -1.300 0.000

Synonym

Accession Q7Z3E2 Q2M2V6 Q3ZB81 Q6NS91 Q7RTP1 Q8N117 Q8N3G3 Q8N6C2 Q9NWA3
Symbols C10orf118

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
C. elegans OMA EggNOG Inparanoid

 Compartment GO Term (1)

AA Sequence

MSETDHIASTSSDKNVGKTPELKEDSCNLFSGNESSKLENESKLLSLNTDKTLCQPNEHNNRIEAQENYI      1 - 70
PDHGGGEDSCAKTDTGSENSEQIANFPSGNFAKHISKTNETEQKVTQILVELRSSTFPESANEKTYSESP     71 - 140
YDTDCTKKFISKIKSVSASEDLLEEIESELLSTEFAEHRVPNGMNKGEHALVLFEKCVQDKYLQQEHIIK    141 - 210
KLIKENKKHQELFVDICSEKDNLREELKKRTETEKQHMNTIKQLESRIEELNKEVKASRDQLIAQDVTAK    211 - 280
NAVQQLHKEMAQRMEQANKKCEEARQEKEAMVMKYVRGEKESLDLRKEKETLEKKLRDANKELEKNTNKI    281 - 350
KQLSQEKGRLHQLYETKEGETTRLIREIDKLKEDINSHVIKVKWAQNKLKAEMDSHKETKDKLKETTTKL    351 - 420
TQAKEEADQIRKNCQDMIKTYQESEEIKSNELDAKLRVTKGELEKQMQEKSDQLEMHHAKIKELEDLKRT    421 - 490
FKEGMDELRTLRTKVKCLEDERLRTEDELSKYKEIINRQKAEIQNLLDKVKTADQLQEQLQRGKQEIENL    491 - 560
KEEVESLNSLINDLQKDIEGSRKRESELLLFTERLTSKNAQLQSESNSLQSQFDKVSCSESQLQSQCEQM    561 - 630
KQTNINLESRLLKEEELRKEEVQTLQAELACRQTEVKALSTQVEELKDELVTQRRKHASSIKDLTKQLQQ    631 - 700
ARRKLDQVESGSYDKEVSSMGSRSSSSGSLNARSSAEDRSPENTGSSVAVDNFPQVDKAMLIERIVRLQK    701 - 770
AHARKNEKIEFMEDHIKQLVEEIRKKTKIIQSYILREESGTLSSEASDFNKVHLSRRGGIMASLYTSHPA    771 - 840
DNGLTLELSLEINRKLQAVLEDTLLKNITLKENLQTLGTEIERLIKHQHELEQRTKKT                841 - 898
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14996095 2004 SEREX identification of new tumour-associated antigens in cutaneous T-cell lymphoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12783626 2003 Gene discovery in the hamster: a comparative genomics approach for gene annotation by sequencing of hamster testis cDNAs.
More...