Property Summary

NCBI Gene PubMed Count 27
Grant Count 4
R01 Count 1
Funding $838,733.7
PubMed Score 20.80
PubTator Score 8.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.300 0.000
lung cancer 1.900 0.005
diabetes mellitus -1.100 0.001

Gene RIF (15)

PMID Text
26711178 Importantly, TBC1D14 and TRAPPIII regulate ATG9 trafficking independently of ULK1.
25461811 These two steps are essential for the maturation of small single-membrane autophagic precursors containing ATG16L1 and mATG9 proteins into double-membrane autophagosomes
25266655 Data found that the interaction between 14-3-3 zeta and Atg9A is mediated by phosphorylation at Ser761.
24819384 D620N mutation in VPS35 restricts WASH complex recruitment to endosomes, inhibiting autophagy. The autophagy defects can be explained, at least in part, by abnormal trafficking of the autophagy protein ATG9A.
24767251 miR-29b mRNA, MAPK10 protein expression, and ATG9A protein expression are closely related to chemosensitivity of ovarian carcinoma.
24603492 TBC1D5 and the AP2 complex are important novel regulators of the rerouting of ATG9-containing vesicular carriers toward sites of autophagosome formation.
24085552 the presence of ATG9A in the cytoplasm of tumor cells may be an independent biomarker for disease recurrence and survival in patients with oral squamous cell carcinoma
22456507 mAtg9 trafficking through multiple organelles, including recycling endosomes, is essential for the initiation and progression of autophagy
21068542 These findings suggest that Bif-1 acts as a critical regulator of Atg9 puncta formation presumably by mediating Golgi fission for autophagosome biogenesis during starvation.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MAQFDTEYQRLEASYSDSPPGEEDLLVHVAEGSKSPWHHIENLDLFFSRVYNLHQKNGFTCMLIGEIFEL      1 - 70
MQFLFVVAFTTFLVSCVDYDILFANKMVNHSLHPTEPVKVTLPDAFLPAQVCSARIQENGSLITILVIAG     71 - 140
VFWIHRLIKFIYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELDIYH    141 - 210
RILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRL    211 - 280
ELAQRLSNRILWIGIANFLLCPLILIWQILYAFFSYAEVLKREPGALGARCWSLYGRCYLRHFNELEHEL    281 - 350
QSRLNRGYKPASKYMNCFLSPLLTLLAKNGAFFAGSILAVLIALTIYDEDVLAVEHVLTTVTLLGVTVTV    351 - 420
CRSFIPDQHMVFCPEQLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLIL    421 - 490
IFCLRPRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTELSLMHF    491 - 560
AITNPGWQPPRESTAFLGFLKEQVQRDGAAASLAQGGLLPENALFTSIQSLQSESEPLSLIANVVAGSSC    561 - 630
RGPPLPRDLQGSRHRAEVASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLVLSE    631 - 700
YASTEMSLHALYMHQLHKQQAQAEPERHVWHRRESDESGESAPDEGGEGARAPQSIPRSASYPCAAPRPG    701 - 770
APETTALHGGFQRRYGGITDPGTVPRVPSHFSRLPLGGWAEDGQSASRHPEPVPEEGSEDELPPQVHKV     771 - 839
//

Text Mined References (39)

PMID Year Title
26711178 2016 TBC1D14 regulates autophagy via the TRAPP complex and ATG9 traffic.
25461811 2015 Methods to analyze SNARE-dependent vesicular fusion events that regulate autophagosome biogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
25266655 2014 Metabolic-stress-induced rearrangement of the 14-3-3? interactome promotes autophagy via a ULK1- and AMPK-regulated 14-3-3? interaction with phosphorylated Atg9.
24819384 2014 Mutation in VPS35 associated with Parkinson's disease impairs WASH complex association and inhibits autophagy.
24767251 2014 Involvement of miR-29b signaling in the sensitivity to chemotherapy in patients with ovarian carcinoma.
24603492 2014 TBC1D5 and the AP2 complex regulate ATG9 trafficking and initiation of autophagy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24085552 2013 ATG9A overexpression is associated with disease recurrence and poor survival in patients with oral squamous cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...