Property Summary

NCBI Gene PubMed Count 21
Grant Count 2
Funding $21,456.8
PubMed Score 5.68
PubTator Score 3.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.350 0.003
sonic hedgehog group medulloblastoma 1.600 0.000
lung cancer 2.200 0.003
pediatric high grade glioma 1.100 0.000
ovarian cancer -1.500 0.000

Synonym

Accession Q7Z3B4 B2RCK7 B4DT35 Q96EA7 Q9NVL5 Q9P0I1
Symbols

Gene

PANTHER Protein Class (1)

 Grant Application (2)

PDB

5IJN   5IJO   4JO7   4JO9   4JNU   4JNV  

Gene RIF (5)

PMID Text
21489275 HIV-1 Vpr binds to nucleoporin p54 in vitro during docking of the HIV-1 preintegration complex at the nuclear envelope
20012529 HIV-1 Vpr binds to nucleoporin p54 in vitro during docking of the HIV-1 preintegration complex at the nuclear envelope
19458171 HIV-1 Vpr binds to nucleoporin p54 in vitro during docking of the HIV-1 preintegration complex at the nuclear envelope
19275582 HIV-1 Vpr binds to nucleoporin p54 in vitro during docking of the HIV-1 preintegration complex at the nuclear envelope
9582382 HIV-1 Vpr binds to nucleoporin p54 in vitro during docking of the HIV-1 preintegration complex at the nuclear envelope

AA Sequence

MAFNFGAPSGTSGTAAATAAPAGGFGGFGTTSTTAGSAFSFSAPTNTGTTGLFGGTQNKGFGFGTGFGTT      1 - 70
TGTSTGLGTGLGTGLGFGGFNTQQQQQTTLGGLFSQPTQAPTQSNQLINTASALSAPTLLGDERDAILAK     71 - 140
WNQLQAFWGTGKGYFNNNIPPVEFTQENPFCRFKAVGYSCMPSNKDEDGLVVLVFNKKETEIRSQQQQLV    141 - 210
ESLHKVLGGNQTLTVNVEGTKTLPDDQTEVVIYVVERSPNGTSRRVPATTLYAHFEQANIKTQLQQLGVT    211 - 280
LSMTRTELSPAQIKQLLQNPPAGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTR    281 - 350
LDIISEDISELQKNQTTSVAKIAQYKRKLMDLSHRTLQVLIKQEIQRKSGYAIQADEEQLRVQLDTIQGE    351 - 420
LNAPTQFKGRLNELMSQIRMQNHFGAVRSEERYYIDADLLREIKQHLKQQQEGLSHLISIIKDDLEDIKL    421 - 490
VEHGLNETIHIRGGVFS                                                         491 - 507
//

Text Mined References (24)

PMID Year Title
27194810 2016 Systematic Protein-Protein Interaction Analysis Reveals Intersubcomplex Contacts in the Nuclear Pore Complex.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
21994455 2011 Generation and comprehensive analysis of an influenza virus polymerase cellular interaction network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...