Property Summary

NCBI Gene PubMed Count 22
PubMed Score 5.89
PubTator Score 3.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.1e-06
pediatric high grade glioma 1064 1.3e-04
lung cancer 4740 2.7e-03
Multiple myeloma 1332 2.7e-03
group 3 medulloblastoma 4104 3.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.500 3.3e-03
lung cancer 2.200 2.7e-03
Multiple myeloma 1.350 2.7e-03
ovarian cancer -1.500 2.1e-06
pediatric high grade glioma 1.100 1.3e-04

Gene RIF (5)

AA Sequence

MAFNFGAPSGTSGTAAATAAPAGGFGGFGTTSTTAGSAFSFSAPTNTGTTGLFGGTQNKGFGFGTGFGTT      1 - 70
TGTSTGLGTGLGTGLGFGGFNTQQQQQTTLGGLFSQPTQAPTQSNQLINTASALSAPTLLGDERDAILAK     71 - 140
WNQLQAFWGTGKGYFNNNIPPVEFTQENPFCRFKAVGYSCMPSNKDEDGLVVLVFNKKETEIRSQQQQLV    141 - 210
ESLHKVLGGNQTLTVNVEGTKTLPDDQTEVVIYVVERSPNGTSRRVPATTLYAHFEQANIKTQLQQLGVT    211 - 280
LSMTRTELSPAQIKQLLQNPPAGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTR    281 - 350
LDIISEDISELQKNQTTSVAKIAQYKRKLMDLSHRTLQVLIKQEIQRKSGYAIQADEEQLRVQLDTIQGE    351 - 420
LNAPTQFKGRLNELMSQIRMQNHFGAVRSEERYYIDADLLREIKQHLKQQQEGLSHLISIIKDDLEDIKL    421 - 490
VEHGLNETIHIRGGVFS                                                         491 - 507
//

Text Mined References (25)

PMID Year Title