Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.100 1.7e-02
aldosterone-producing adenoma -1.134 6.9e-03
Astrocytoma, Pilocytic 1.500 3.6e-06
atypical teratoid / rhabdoid tumor 1.100 1.8e-04
ependymoma -1.100 2.3e-02
glioblastoma 1.300 4.2e-06
group 3 medulloblastoma 1.600 1.6e-03
nasopharyngeal carcinoma 1.100 3.9e-04
non-small cell lung cancer 1.018 6.3e-13
osteosarcoma 2.730 3.4e-05
pituitary cancer 1.200 2.2e-05
progressive supranuclear palsy -1.100 1.4e-02
psoriasis 1.800 2.0e-04

AA Sequence

MAEEEGPPVELRQRKKPKSSENKESAKEEKISDIPIPERAPKHVLFQRFAKIFIGCLAAVTSGMMYALYL      1 - 70
SAYHERKFWFSNRQELEREITFQGDSAIYYSYYKDMLKAPSFERGVYELTHNNKTVSLKTINAVQQMSLY     71 - 140
PELIASILYQATGSNEIIEPVYFYIGIVFGLQGIYVTALFVTSWLMSGTWLAGMLTVAWFVINRVDTTRI    141 - 210
EYSIPLRENWALPYFACQIAALTGYLKSNLNTYGERFCYLLMSASTYTFMMMWEYSHYLLFLQAISLFLL    211 - 280
DTFSVEQSDKVYEVYKIYIFSLFLGYLLQFENPALLVSPLLSLVAALMLAKCLQLNVKKGSFVAKIIKVI    281 - 350
NFYLVCTLTITLNIIMKMFVPHKENGHMLKFLEVKFGLNMTKNFTMNWLLCQESLQAPSQDFFLRLTQSS    351 - 420
LLPFYILVLIICFLSMLQVIFRRINGKSLKETVTLEDGRIGERPEIIYHVIHTILLGSLAMVIEGLKYIW    421 - 490
IPYVCMLAAFGVCSPELWMTLFKWLRLRTVHPILLALILSMAVPTIIGLSLWKEFFPRLMTELMELQEFY    491 - 560
DPDTVELMTWIKRQAPVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKRSAEDIY    561 - 630
KILTSYKANYLIVEDAICNEVGPMRGCRVKDLLDIANGHMVCEEGDKLTYSKYGRFCHEVKINYSPYVNY    631 - 700
FTRVYWNRSYFVYKINTVISFQS                                                   701 - 723
//

Text Mined References (11)

PMID Year Title