Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma 1.500 0.000
psoriasis 1.800 0.000
glioblastoma 1.300 0.000
osteosarcoma 2.730 0.000
atypical teratoid/rhabdoid tumor 1.200 0.000
non-small cell lung cancer 1.018 0.000
pediatric high grade glioma 1.200 0.000
group 3 medulloblastoma 1.600 0.002
pilocytic astrocytoma 1.600 0.000
aldosterone-producing adenoma -1.134 0.007
nasopharyngeal carcinoma 1.100 0.000
progressive supranuclear palsy -1.100 0.014
pituitary cancer 1.200 0.000

Synonym

Accession Q7Z388 Q6ZW32 Q6ZW42 Q7Z329
Symbols

Gene

AA Sequence

MAEEEGPPVELRQRKKPKSSENKESAKEEKISDIPIPERAPKHVLFQRFAKIFIGCLAAVTSGMMYALYL      1 - 70
SAYHERKFWFSNRQELEREITFQGDSAIYYSYYKDMLKAPSFERGVYELTHNNKTVSLKTINAVQQMSLY     71 - 140
PELIASILYQATGSNEIIEPVYFYIGIVFGLQGIYVTALFVTSWLMSGTWLAGMLTVAWFVINRVDTTRI    141 - 210
EYSIPLRENWALPYFACQIAALTGYLKSNLNTYGERFCYLLMSASTYTFMMMWEYSHYLLFLQAISLFLL    211 - 280
DTFSVEQSDKVYEVYKIYIFSLFLGYLLQFENPALLVSPLLSLVAALMLAKCLQLNVKKGSFVAKIIKVI    281 - 350
NFYLVCTLTITLNIIMKMFVPHKENGHMLKFLEVKFGLNMTKNFTMNWLLCQESLQAPSQDFFLRLTQSS    351 - 420
LLPFYILVLIICFLSMLQVIFRRINGKSLKETVTLEDGRIGERPEIIYHVIHTILLGSLAMVIEGLKYIW    421 - 490
IPYVCMLAAFGVCSPELWMTLFKWLRLRTVHPILLALILSMAVPTIIGLSLWKEFFPRLMTELMELQEFY    491 - 560
DPDTVELMTWIKRQAPVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKRSAEDIY    561 - 630
KILTSYKANYLIVEDAICNEVGPMRGCRVKDLLDIANGHMVCEEGDKLTYSKYGRFCHEVKINYSPYVNY    631 - 700
FTRVYWNRSYFVYKINTVISFQS                                                   701 - 723
//

Text Mined References (11)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
16526957 2006 Duplication and relocation of the functional DPY19L2 gene within low copy repeats.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
More...