Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma multiforme 347 1.27444325182218E-13
ovarian cancer 8492 5.07842294525028E-9
malignant mesothelioma 3163 6.32097160989815E-7
sonic hedgehog group medulloblastoma 1482 2.65698187774381E-5
osteosarcoma 7933 3.13477898738689E-5
medulloblastoma, large-cell 6234 1.89227206095344E-4
primitive neuroectodermal tumor 3031 3.41417520375913E-4
lung cancer 4473 0.00403088783823864
atypical teratoid / rhabdoid tumor 4369 0.00645489417333526
adrenocortical carcinoma 1427 0.00942135502706513

Expression

  Differential Expression (10)

Synonym

Accession Q7Z340 B4DU22 P17034 Q8N246 Q9BRY1
Symbols

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG

AA Sequence

MPAPVGRRSPPSPRSSMAAVALRDSAQGMTFEDVAIYFSQEEWELLDESQRFLYCDVMLENFAHVTSLGY      1 - 70
CHGMENEAIASEQSVSIQVRTSKGNTPTQKTHLSEIKMCVPVLKDILPAAEHQTTSPVQKSYLGSTSMRG     71 - 140
FCFSADLHQHQKHYNEEEPWKRKVDEATFVTGCRFHVLNYFTCGEAFPAPTDLLQHEATPSGEEPHSSSS    141 - 210
KHIQAFFNAKSYYKWGEYRKASSHKHTLVQHQSVCSEGGLYECSKCEKAFTCKNTLVQHQQIHTGQKMFE    211 - 280
CSECEESFSKKCHLILHKIIHTGERPYECSDREKAFIHKSEFIHHQRRHTGGVRHECGECRKTFSYKSNL    281 - 350
IEHQRVHTGERPYECGECGKSFRQSSSLFRHQRVHSGERPYQCCECGKSFRQIFNLIRHRRVHTGEMPYQ    351 - 420
CSDCGKSFSCKSELIQHQRIHSGERPYECRECGKSFRQFSNLIRHRSIHTGDRPYECSECEKSFSRKFIL    421 - 490
IQHQRVHTGERPYECSECGKSFTRKSDLIQHRRIHTGTRPYECSECGKSFRQRSGLIQHRRLHTGERPYE    491 - 560
CSECGKSFSQSASLIQHQRVHTGERPYECSECGKSFSQSSSLIQHQRGHTGERPYECSQCGKPFTHKSDL    561 - 630
IQHQRVHTGERPYECSECGKSFSRKSNLIRHRRVHTEERP                                  631 - 670
//

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.