Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma 1.009 9.4e-03
atypical teratoid / rhabdoid tumor 1.100 6.5e-03
glioblastoma 1.200 5.0e-05
group 3 medulloblastoma 1.400 3.5e-03
lung cancer 1.100 4.0e-03
malignant mesothelioma 1.500 6.3e-07
medulloblastoma, large-cell 1.700 1.9e-04
osteosarcoma 2.451 3.1e-05
ovarian cancer 1.200 5.1e-09
primitive neuroectodermal tumor 1.300 3.4e-04

AA Sequence

MPAPVGRRSPPSPRSSMAAVALRDSAQGMTFEDVAIYFSQEEWELLDESQRFLYCDVMLENFAHVTSLGY      1 - 70
CHGMENEAIASEQSVSIQVRTSKGNTPTQKTHLSEIKMCVPVLKDILPAAEHQTTSPVQKSYLGSTSMRG     71 - 140
FCFSADLHQHQKHYNEEEPWKRKVDEATFVTGCRFHVLNYFTCGEAFPAPTDLLQHEATPSGEEPHSSSS    141 - 210
KHIQAFFNAKSYYKWGEYRKASSHKHTLVQHQSVCSEGGLYECSKCEKAFTCKNTLVQHQQIHTGQKMFE    211 - 280
CSECEESFSKKCHLILHKIIHTGERPYECSDREKAFIHKSEFIHHQRRHTGGVRHECGECRKTFSYKSNL    281 - 350
IEHQRVHTGERPYECGECGKSFRQSSSLFRHQRVHSGERPYQCCECGKSFRQIFNLIRHRRVHTGEMPYQ    351 - 420
CSDCGKSFSCKSELIQHQRIHSGERPYECRECGKSFRQFSNLIRHRSIHTGDRPYECSECEKSFSRKFIL    421 - 490
IQHQRVHTGERPYECSECGKSFTRKSDLIQHRRIHTGTRPYECSECGKSFRQRSGLIQHRRLHTGERPYE    491 - 560
CSECGKSFSQSASLIQHQRVHTGERPYECSECGKSFSQSSSLIQHQRGHTGERPYECSQCGKPFTHKSDL    561 - 630
IQHQRVHTGERPYECSECGKSFSRKSNLIRHRRVHTEERP                                  631 - 670
//

Text Mined References (9)

PMID Year Title