Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.53
PubTator Score 0.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.031 1.5e-03
adult high grade glioma 1.600 6.1e-06
astrocytic glioma -1.200 2.7e-02
Astrocytoma, Pilocytic 1.600 3.2e-09
atypical teratoid / rhabdoid tumor -1.300 1.5e-03
ependymoma -1.500 2.3e-02
glioblastoma 2.000 2.2e-11
group 3 medulloblastoma 1.400 1.3e-03
intraductal papillary-mucinous adenoma (... 1.300 1.4e-02
intraductal papillary-mucinous carcinoma... 1.300 8.0e-03
intraductal papillary-mucinous neoplasm ... 1.800 4.8e-03
invasive ductal carcinoma 1.100 3.2e-04
juvenile dermatomyositis 1.235 5.1e-11
medulloblastoma, large-cell -1.400 1.3e-04
oligodendroglioma -1.100 3.7e-02
osteosarcoma -1.142 4.1e-03
ovarian cancer -1.100 9.6e-03
primitive neuroectodermal tumor 1.800 2.0e-04
tuberculosis 1.100 9.8e-08

AA Sequence

MAQEKMELDLEPDTSYGGTLRRSSSAPLIHGLSDLSQVFQPYTLRTRRNSTTIMSRHSLEEGLDMVNRET      1 - 70
AHEREMQTAMQISQSWDESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGKMFVSSSGLPPSPVP     71 - 140
SPRRFSRRSQSPVKCIRPSVLGPLKRKGEMETESQPKRLFQGTTNMLSPDAAQLSDLSSCSDILDGSSSS    141 - 210
SGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK                                     211 - 247
//

Text Mined References (23)

PMID Year Title