Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.52
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 3.72451623703773E-40
Breast cancer 3099 9.15486959781723E-32
non-small cell lung cancer 2798 5.55387714555919E-29
lung carcinoma 2844 3.15203276455006E-19
psoriasis 6685 4.18793155349874E-18
lung adenocarcinoma 2714 7.66502506639719E-18
periodontitis 269 1.41942004006035E-13
ovarian cancer 8492 5.6587480562506E-9
cystic fibrosis 1670 9.20729458799895E-7
Duchenne muscular dystrophy 602 1.06166757360874E-5
fascioscapulohumeral muscular dystrophy 100 2.18206362948265E-4
invasive ductal carcinoma 2950 2.76202419354111E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.19545568542725E-4
ductal carcinoma in situ 1745 5.77090379087387E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00102326326739622
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00199561281292083
limb girdle muscular dystrophy 2A 156 0.00253545918243693
Atopic dermatitis 944 0.00338133043616732
adrenocortical carcinoma 1427 0.00499836128161476
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00551248889763484
Disease Target Count Z-score Confidence
Kabuki syndrome 29 3.3 1.6
Keratoconus 49 3.1 1.5

Expression

Synonym

Accession Q7Z304 Q5VW47 Q8WX43 Q96BM4
Symbols

Gene

  Ortholog (12)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLLRGVLLALQALQLAGALDLPAGSCAFEESTCGFDSVLASLPWILNEEGHYIYVDTSFGKQGEKAVLLS      1 - 70
PDLQAEEWSCLRLVYQITTSSESLSDPSQLNLYMRFEDESFDRLLWSAKEPSDSWLIASLDLQNSSKKFK     71 - 140
ILIEGVLGQGNTASIALFEIKMTTGYCIECDFEENHLCGFVNRWNPNVNWFVGGGSIRNVHSILPQDHTF    141 - 210
KSELGHYMYVDSVYVKHFQEVAQLISPLTTAPMAGCLSFYYQIQQGNDNVFSLYTRDVAGLYEEIWKADR    211 - 280
PGNAAWNLAEVEFSAPYPMEVIFEVAFNGPKGGYVALDDISFSPVHCQNQTELLFSAVEASCNFEQDLCN    281 - 350
FYQDKEGPGWTRVKVKPNMYRAGDHTTGLGYYLLANTKFTSQPGYIGRLYGPSLPGNLQYCLRFHYAIYG    351 - 420
FLKMSDTLAVYIFEENHVVQEKIWSVLESPRGVWMQAEITFKKPMPTKVVFMSLCKSFWDCGLVALDDIT    421 - 490
IQLGSCSSSEKLPPPPGECTFEQDECTFTQEKRNRSSWHRRRGETPTSYTGPKGDHTTGVGYYMYIEASH    491 - 560
MVYGQKARLLSRPLRGVSGKHCLTFFYHMYGGGTGLLSVYLKKEEDSEESLLWRRRGEQSISWLRALIEY    561 - 630
SCERQHQIIFEAIRGVSIRSDIAIDDVKFQAGPCGEMEDTTQQSSGYSEDLNEIEY                  631 - 686
//

Text Mined References (9)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.