Property Summary

NCBI Gene PubMed Count 9
PubMed Score 18.70
PubTator Score 16.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 1.25239255064075E-6
lung cancer 4473 0.00106553637804437
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00249700905217823
Disease Target Count Z-score Confidence
Shwachman-Diamond syndrome 16 5.477 2.7
Myxedema 8 3.018 1.5

Expression

  Differential Expression (3)

Gene RIF (4)

PMID Text
26479198 Upon EFL1 binding, SBDS is repositioned around helix 69, thus facilitating a conformational switch in EFL1 that displaces eIF6 by competing for an overlapping binding site on the 60S ribosomal subunit.
25015090 Downregulation of EFTUD1 induced cell-cycle arrest and apoptosis in gliomas by impairing ribosome biogenesis
23898208 HIV-1 Tat downregulates the expression of elongation factor Tu GTP binding domain containing 1 (EFTUD1) in human primary T cells
20966410 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVLNSLDKMIQLQKNTANIRNICVLAHVDHGKTTLADCLISSNGIISSRLAGKLRYMDSREDEQIRGITM      1 - 70
KSSAISLHYATGNEEYLINLIDSPGHVDFSSEVSTAVRICDGCIIVVDAVEGVCPQTQAVLRQAWLENIR     71 - 140
PVLVINKIDRLIVELKFTPQEAYSHLKNILEQINALTGTLFTSKVLEERAERETESQVNPNSEQGEQVYD    141 - 210
WSTGLEDTDDSHLYFSPEQGNVVFTSAIDGWGFGIEHFARIYSQKIGIKKEVLMKTLWGDYYINMKAKKI    211 - 280
MKGDQAKGKKPLFVQLILENIWSLYDAVLKKDKDKIDKIVTSLGLKIGAREARHSDPKVQINAICSQWLP    281 - 350
ISHAVLAMVCQKLPSPLDITAERVERLMCTGSQTFDSFPPETQALKAAFMKCGSEDTAPVIIFVSKMFAV    351 - 420
DAKALPQNKPRPLTQEEIAQRRERARQRHAEKLAAAQGQAPLEPTQDGSAIETCPKGEEPRGDEQQVESM    421 - 490
TPKPVLQEENNQESFIAFARVFSGVARRGKKIFVLGPKYSPLEFLRRVPLGFSAPPDGLPQVPHMAYCAL    491 - 560
ENLYLLMGRELEYLEEVPPGNVLGIGGLQDFVLKSATLCSLPSCPPFIPLNFEATPIVRVAVEPKHPSEM    561 - 630
PQLVKGMKLLNQADPCVQILIQETGEHVLVTAGEVHLQRCLDDLKERFAKIHISVSEPIIPFRETITKPP    631 - 700
KVDMVNEEIGKQQKVAVIHQMKEDQSKIPEGIQVDSDGLITITTPNKLATLSVRAMPLPEEVTQILEENS    701 - 770
DLIRSMEQLTSSLNEGENTHMIHQKTQEKIWEFKGKLEQHLTGRRWRNIVDQIWSFGPRKCGPNILVNKS    771 - 840
EDFQNSVWTGPADKASKEASRYRDLGNSIVSGFQLATLSGPMCEEPLMGVCFVLEKWDLSKFEEQGASDL    841 - 910
AKEGQEENETCSGGNENQELQDGCSEAFEKRTSQKGESPLTDCYGPFSGQLIATMKEACRYALQVKPQRL    911 - 980
MAAMYTCDIMATGDVLGRVYAVLSKREGRVLQEEMKEGTDMFIIKAVLPVAESFGFADEIRKRTSGLASP    981 - 1050
QLVFSHWEIIPSDPFWVPTTEEEYLHFGEKADSENQARKYMNAVRKRKGLYVEEKIVEHAEKQRTLSKNK   1051 - 1120
//

Text Mined References (14)

PMID Year Title
26479198 2015 Mechanism of eIF6 release from the nascent 60S ribosomal subunit.
25015090 2014 Functional analysis of a novel glioma antigen, EFTUD1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21536732 2011 Uncoupling of GTP hydrolysis from eIF6 release on the ribosome causes Shwachman-Diamond syndrome.
21269460 2011 Initial characterization of the human central proteome.
20966410 2010 Genomewide linkage and peakwide association analyses of carotid plaque in Caribbean Hispanics.
20531441 2010 CAMOS, a nonprogressive, autosomal recessive, congenital cerebellar ataxia, is caused by a mutant zinc-finger protein, ZNF592.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
More...