Property Summary

NCBI Gene PubMed Count 16
Grant Count 10
R01 Count 5
Funding $1,933,476.7
PubMed Score 21.28
PubTator Score 16.98

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
26405041 identified a point mutation of Sld3 that is specifically defective for Mcm3 and Mcm5 interaction (sld3-m10), and also identified a point mutation of Sld3 that is specifically defective for single-stranded DNA interaction (sld3-m9)
25737283 phosphorylated TICRR is limiting for S-phase progression
23704573 MTBP acts with Treslin/TICRR to integrate signals from cell cycle and DNA damage response pathways to control the initiation of DNA replication in human cells.
23696651 Treslin is a dual replication/checkpoint protein that directly participates in ATR-mediated checkpoint signaling
21646402 Results indicate that Cdk-mediated phosphorylation of Treslin during S phase is necessary for both its effective association with TopBP1 and its ability to promote DNA replication in human cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20116089 Results indicate that Treslin and TopBP1 collaborate in the Cdk2-mediated loading of Cdc45 onto replication origins; treslin regulates a pivotal step in the initiation of DNA replication in vertebrates.
20080954 TICRR acts in association with TopBP1 and plays an essential role in preinitiation complex formation [TICRR = TopBP1-interacting, checkpoint, and replication regulator]

AA Sequence

MACCHKVMLLLDTAGGAARHSRVRRAALRLLTYLSCRFGLARVHWAFKFFDSQGARSRPSRVSDFRELGS      1 - 70
RSWEDFEEELEARLEDRAHLPGPAPRATHTHGALMETLLDYQWDRPEITSPTKPILRSSGRRLLDVESEA     71 - 140
KEAEAALGGLVNAVFLLAPCPHSQRELLQFVSGCEAQAQRLPPTPKQVMEKLLPKRVREVMVARKITFYW    141 - 210
VDTTEWSKLWESPDHLGYWTVCELLHHGGGTVLPSESFSWDFAQAGEMLLRSGIKLSSEPHLSPWISMLP    211 - 280
TDATLNRLLYNSPEYEASFPRMEGMLFLPVEAGKEIQETWTVTLEPLAMHQRHFQKPVRIFLKGSVAQWS    281 - 350
LPTSSTLGTDSWMLGSPEESTATQRLLFQQLVSRLTAEELHLVADVDPGEGRPPITGVISPLSASAMILT    351 - 420
VCRTKEAEFQRHVLQTAVADSPRDTASLFSDVVDSILNQTHDSLADTASAASPVPEWAQQELGHTTPWSP    421 - 490
AVVEKWFPFCNISGASSDLMESFGLLQAASANKEESSKTEGELIHCLAELYQRKSREESTIAHQEDSKKK    491 - 560
RGVPRTPVRQKMNTMCRSLKMLNVARLNVKAQKLHPDGSPDVAGEKGIQKIPSGRTVDKLEDRGRTLRSS    561 - 630
KPKDFKTEEELLSYIRENYQKTVATGEIMLYACARNMISTVKMFLKSKGTKELEVNCLNQVKSSLLKTSK    631 - 700
SLRQNLGKKLDKEDKVRECQLQVFLRLEMCLQCPSINESTDDMEQVVEEVTDLLRMVCLTEDSAYLAEFL    701 - 770
EEILRLYIDSIPKTLGNLYNSLGFVIPQKLAGVLPTDFFSDDSMTQENKSPLLSVPFLSSARRSVSGSPE    771 - 840
SDELQELRTRSAKKRRKNALIRHKSIAEVSQNLRQIEIPKVSKRATKKENSHPAPQQPSQPVKDTVQEVT    841 - 910
KVRRNLFNQELLSPSKRSLKRGLPRSHSVSAVDGLEDKLDNFKKNKGYHKLLTKSVAETPVHKQISKRLL    911 - 980
HRQIKGRSSDPGPDIGVVEESPEKGDEISLRRSPRIKQLSFSRTHSASFYSVSQPKSRSVQRVHSFQQDK    981 - 1050
SDQRENSPVQSIRSPKSLLFGAMSEMISPSEKGSARMKKRSRNTLDSEVPAAYQTPKKSHQKSLSFSKTT   1051 - 1120
PRRISHTPQTPLYTPERLQKSPAKMTPTKQAAFKESLKDSSSPGHDSPLDSKITPQKRHTQAGEGTSLET   1121 - 1190
KTPRTPKRQGTQPPGFLPNCTWPHSVNSSPESPSCPAPPTSSTAQPRRECLTPIRDPLRTPPRAAAFMGT   1191 - 1260
PQNQTHQQPHVLRAARAEEPAQKLKDKAIKTPKRPGNSTVTSSPPVTPKKLFTSPLCDVSKKSPFRKSKI   1261 - 1330
ECPSPGELDQKEPQMSPSVAASLSCPVPSTPPELSQRATLDTVPPPPPSKVGKRCRKTSDPRRSIVECQP   1331 - 1400
DASATPGVGTADSPAAPTDSRDDQKGLSLSPQSPPERRGYPGPGLRSDWHASSPLLITSDTEHVTLLSEA   1401 - 1470
EHHGIGDLKSNVLSVEEGEGLRTADAEKSSLSHPGIPPSPPSCGPGSPLMPSRDVHCTTDGRQCQASAQL   1471 - 1540
DNLPASAWHSTDSASPQTYEVELEMQASGLPKLRIKKIDPSSSLEAEPLSKEESSLGEESFLPALSMPRA   1541 - 1610
SRSLSKPEPTYVSPPCPRLSHSTPGKSRGQTYICQACTPTHGPSSTPSPFQTDGVPWTPSPKHSGKTTPD   1611 - 1680
IIKDWPRRKRAVGCGAGSSSGRGEVGADLPGSLSLLESEGKDHGLELSIHRTPILEDFELEGVCQLPDQS   1681 - 1750
PPRNSMPKAEEASSWGQFGLSSRKRVLLAKEEADRGAKRICDLREDSEVSKSKEGSPSWSAWQLPSTGDE   1751 - 1820
EVFVSGSTPPPSCAVRSCLSASALQALTQSPLLFQGKTPSSQSKDPRDEDVDVLPSTVEDSPFSRAFSRR   1821 - 1890
RPISRTYTRKKLMGTWLEDL                                                     1891 - 1910
//

Text Mined References (25)

PMID Year Title
26405041 2015 The Replication Initiation Protein Sld3/Treslin Orchestrates the Assembly of the Replication Fork Helicase during S Phase.
25737283 2015 Cyclin-dependent kinase regulates the length of S phase through TICRR/TRESLIN phosphorylation.
24825563 2014 Common genetic variants associated with resting oxygenation in chronic obstructive pulmonary disease.
23704573 2013 Identification of a heteromeric complex that promotes DNA replication origin firing in human cells.
23696651 2013 Direct role for the replication protein treslin (Ticrr) in the ATR kinase-mediated checkpoint response.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22380713 2012 Treslin, DUE-B, and GEMC1 cannot complement Sld3 mutants in fission yeast.
21816347 2011 Quantitative proteomics reveals the basis for the biochemical specificity of the cell-cycle machinery.
21700459 2011 Regulation of DNA replication through Sld3-Dpb11 interaction is conserved from yeast to humans.
More...