Property Summary

NCBI Gene PubMed Count 16
PubMed Score 21.28
PubTator Score 16.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
psoriasis 6685 1.753108802631E-181
non-small cell lung carcinoma 413 7.55840881417214E-18
lung adenocarcinoma 2714 2.8771356707131E-11
ovarian cancer 8492 9.77933125306737E-8
sonic hedgehog group medulloblastoma 1482 2.24889820561133E-4
breast carcinoma 1614 4.16013740169265E-4
medulloblastoma, large-cell 6234 4.55025487160776E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.99584482905136E-4
inflammatory breast cancer 404 0.00157166891875199
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q7Z2Z1 B2RE07 B3KVV9 D3IUT4 Q8N4X8 Q8NCH6 Q9BU55
Symbols SLD3
Treslin
C15orf42

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
26405041 identified a point mutation of Sld3 that is specifically defective for Mcm3 and Mcm5 interaction (sld3-m10), and also identified a point mutation of Sld3 that is specifically defective for single-stranded DNA interaction (sld3-m9)
25737283 phosphorylated TICRR is limiting for S-phase progression
23704573 MTBP acts with Treslin/TICRR to integrate signals from cell cycle and DNA damage response pathways to control the initiation of DNA replication in human cells.
23696651 Treslin is a dual replication/checkpoint protein that directly participates in ATR-mediated checkpoint signaling
21646402 Results indicate that Cdk-mediated phosphorylation of Treslin during S phase is necessary for both its effective association with TopBP1 and its ability to promote DNA replication in human cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20116089 Results indicate that Treslin and TopBP1 collaborate in the Cdk2-mediated loading of Cdc45 onto replication origins; treslin regulates a pivotal step in the initiation of DNA replication in vertebrates.
20080954 TICRR acts in association with TopBP1 and plays an essential role in preinitiation complex formation [TICRR = TopBP1-interacting, checkpoint, and replication regulator]

AA Sequence

MACCHKVMLLLDTAGGAARHSRVRRAALRLLTYLSCRFGLARVHWAFKFFDSQGARSRPSRVSDFRELGS      1 - 70
RSWEDFEEELEARLEDRAHLPGPAPRATHTHGALMETLLDYQWDRPEITSPTKPILRSSGRRLLDVESEA     71 - 140
KEAEAALGGLVNAVFLLAPCPHSQRELLQFVSGCEAQAQRLPPTPKQVMEKLLPKRVREVMVARKITFYW    141 - 210
VDTTEWSKLWESPDHLGYWTVCELLHHGGGTVLPSESFSWDFAQAGEMLLRSGIKLSSEPHLSPWISMLP    211 - 280
TDATLNRLLYNSPEYEASFPRMEGMLFLPVEAGKEIQETWTVTLEPLAMHQRHFQKPVRIFLKGSVAQWS    281 - 350
LPTSSTLGTDSWMLGSPEESTATQRLLFQQLVSRLTAEELHLVADVDPGEGRPPITGVISPLSASAMILT    351 - 420
VCRTKEAEFQRHVLQTAVADSPRDTASLFSDVVDSILNQTHDSLADTASAASPVPEWAQQELGHTTPWSP    421 - 490
AVVEKWFPFCNISGASSDLMESFGLLQAASANKEESSKTEGELIHCLAELYQRKSREESTIAHQEDSKKK    491 - 560
RGVPRTPVRQKMNTMCRSLKMLNVARLNVKAQKLHPDGSPDVAGEKGIQKIPSGRTVDKLEDRGRTLRSS    561 - 630
KPKDFKTEEELLSYIRENYQKTVATGEIMLYACARNMISTVKMFLKSKGTKELEVNCLNQVKSSLLKTSK    631 - 700
SLRQNLGKKLDKEDKVRECQLQVFLRLEMCLQCPSINESTDDMEQVVEEVTDLLRMVCLTEDSAYLAEFL    701 - 770
EEILRLYIDSIPKTLGNLYNSLGFVIPQKLAGVLPTDFFSDDSMTQENKSPLLSVPFLSSARRSVSGSPE    771 - 840
SDELQELRTRSAKKRRKNALIRHKSIAEVSQNLRQIEIPKVSKRATKKENSHPAPQQPSQPVKDTVQEVT    841 - 910
KVRRNLFNQELLSPSKRSLKRGLPRSHSVSAVDGLEDKLDNFKKNKGYHKLLTKSVAETPVHKQISKRLL    911 - 980
HRQIKGRSSDPGPDIGVVEESPEKGDEISLRRSPRIKQLSFSRTHSASFYSVSQPKSRSVQRVHSFQQDK    981 - 1050
SDQRENSPVQSIRSPKSLLFGAMSEMISPSEKGSARMKKRSRNTLDSEVPAAYQTPKKSHQKSLSFSKTT   1051 - 1120
PRRISHTPQTPLYTPERLQKSPAKMTPTKQAAFKESLKDSSSPGHDSPLDSKITPQKRHTQAGEGTSLET   1121 - 1190
KTPRTPKRQGTQPPGFLPNCTWPHSVNSSPESPSCPAPPTSSTAQPRRECLTPIRDPLRTPPRAAAFMGT   1191 - 1260
PQNQTHQQPHVLRAARAEEPAQKLKDKAIKTPKRPGNSTVTSSPPVTPKKLFTSPLCDVSKKSPFRKSKI   1261 - 1330
ECPSPGELDQKEPQMSPSVAASLSCPVPSTPPELSQRATLDTVPPPPPSKVGKRCRKTSDPRRSIVECQP   1331 - 1400
DASATPGVGTADSPAAPTDSRDDQKGLSLSPQSPPERRGYPGPGLRSDWHASSPLLITSDTEHVTLLSEA   1401 - 1470
EHHGIGDLKSNVLSVEEGEGLRTADAEKSSLSHPGIPPSPPSCGPGSPLMPSRDVHCTTDGRQCQASAQL   1471 - 1540
DNLPASAWHSTDSASPQTYEVELEMQASGLPKLRIKKIDPSSSLEAEPLSKEESSLGEESFLPALSMPRA   1541 - 1610
SRSLSKPEPTYVSPPCPRLSHSTPGKSRGQTYICQACTPTHGPSSTPSPFQTDGVPWTPSPKHSGKTTPD   1611 - 1680
IIKDWPRRKRAVGCGAGSSSGRGEVGADLPGSLSLLESEGKDHGLELSIHRTPILEDFELEGVCQLPDQS   1681 - 1750
PPRNSMPKAEEASSWGQFGLSSRKRVLLAKEEADRGAKRICDLREDSEVSKSKEGSPSWSAWQLPSTGDE   1751 - 1820
EVFVSGSTPPPSCAVRSCLSASALQALTQSPLLFQGKTPSSQSKDPRDEDVDVLPSTVEDSPFSRAFSRR   1821 - 1890
RPISRTYTRKKLMGTWLEDL                                                     1891 - 1910
//

Text Mined References (25)

PMID Year Title
26405041 2015 The Replication Initiation Protein Sld3/Treslin Orchestrates the Assembly of the Replication Fork Helicase during S Phase.
25737283 2015 Cyclin-dependent kinase regulates the length of S phase through TICRR/TRESLIN phosphorylation.
24825563 2014 Common genetic variants associated with resting oxygenation in chronic obstructive pulmonary disease.
23704573 2013 Identification of a heteromeric complex that promotes DNA replication origin firing in human cells.
23696651 2013 Direct role for the replication protein treslin (Ticrr) in the ATR kinase-mediated checkpoint response.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22380713 2012 Treslin, DUE-B, and GEMC1 cannot complement Sld3 mutants in fission yeast.
21816347 2011 Quantitative proteomics reveals the basis for the biochemical specificity of the cell-cycle machinery.
21700459 2011 Regulation of DNA replication through Sld3-Dpb11 interaction is conserved from yeast to humans.
More...