Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 2.300 0.001
osteosarcoma -1.111 0.025
lung cancer -2.500 0.000
sarcoidosis 1.100 0.008
interstitial cystitis 1.400 0.024
primary Sjogren syndrome 1.200 0.000
lung carcinoma -2.300 0.000

Synonym

Accession Q7Z2Y8 A6NFL2 Q9H8N5
Symbols GVIN1
VLIG1
GVIN1P
VLIG-1

Gene

 GO Function (1)

 GO Component (2)

 Compartment GO Term (0)

AA Sequence

MATGEHTPDDPLLRGKRRQDLQEMLREVGLDVEYWLPKLQEHLGVTCAQALQHLDKNNLKKLKSQTQHPW      1 - 70
EKLLNLSHSKSLSALLQESQVERAKRKQKQAEQALQELRDLLTEGKQRQEEAVRTREAELRQAMDIPEEY     71 - 140
WPSPEEPLRELMENLQRQLNLMKWTLCHRQNLPDRDVVRWASGGLALQGIYKASHQRGLTEKREELLSVP    141 - 210
KEFLLLGPQQGTQMKTKEFTSPQAEFMFTQMVEKLGFRLTTSAKDGNWGFSLEAGLDHSKHPESKETQQS    211 - 280
SSENSYFCSTKFSYIPLASCHFPIDQLQLSKPAVQELKCIEELLSQTTNPDRFSLLRHRIINFFHRFGSH    281 - 350
VNQGPLHLGGIYWWKAISEGYCTEQLAEVRQQSAEALDIFIRDSYSGFGVKVAAGVNVSDSHSKTATQTK    351 - 420
TSQNLQTKVQLSVAQTGGPPEADGLVQWKAGLIASNQTWCVIDRGLQLVPVWDIILSSHRSNFKDPLQVA    421 - 490
NFLKDSYTALTSITAQIQNGEELLSAGKEARVFLEDVKSWEVSDPEEQLKKLINFMKMLSQKLKSYDTWI    491 - 560
NICLTDSLQNFLVNTINFCKKSSIYKTKCIKSHLRSLLDPHIYRVTNFPQAHFIMQWIFQSDSEQEQVNI    561 - 630
SQFSQLIEILKETQNNLMEVKVKSESPETVEEAQRKSTYEVSLALSCFLNYLQKTEQTDTQLLLLSIAAA    631 - 700
AGYHVINNTFQSLLGCDELSFLLDEMQTAQNKYQELKNICSYRAQAFLVLTGLTATVGDTAISSEEKTQR    701 - 770
MSLMRHHMGQSLSKEVAHVLTKPGADHDWENLEKDLRLLINGDYEEVTISSLQMEEVSKQSLFYGKKQPH    771 - 840
EPHDNENNKWEMIKNGAFLDLLQHLGLEHYYPKKLSKANFHLIYKTSVYNTQPSSEQELPFYFLQKLLMM    841 - 910
DYELRYLVFKDDRNTEHQVHPNASDQEDEAFDPYENFFEDSDSPTKSSSTEPSPHIHPVDIQMTIFHCAD    911 - 980
NFARQYILAKLSTCQFALPLLVPNPCTSQIEFSLWSLRQITRSWQEARKSPKGKNYYKNQQMCCVSTSIV    981 - 1050
SFVRVGNGLSASKSQIMNCLLSKRKHDVFFHRHCTGSRKDCLLMGGMVEICWFCPGGEDEDRFDNCVTFT   1051 - 1120
NLHGDAKEHEQQLSFLKEVSTVIVVLMSASDDNEGNRKIVRNLWQSSRPLICLLDDKEATMTNISGQRMR   1121 - 1190
MGIKNRNEAELTEELTTTIRHLLELSDTALSLEDCSQIAHQQGFLIDEDQRDCKEAKEKAQALMAFLGKM   1191 - 1260
KLSQIKEKLLPLQGQLWHHWCKKDKELYHLREKGNQSIEQHKSEIETDKQIIRHEQLARALPLNDLMQSV   1261 - 1330
LQFLQEHSEIHTKLYFLQWLSVFLDKLTAGHLEELHEKQKYWWSLVQTVKQKAPNSHSLICLQSEIEAIS   1331 - 1400
TEISDCTLGIEQLIREVGQIYEALEEASSIKKIFFSLPQIAADLMISGVPIELMDGDAAYVPLTWVAAVF   1401 - 1470
DKVSEKLGDKRLFVLSILGLQSSGKSTVLNALFGLQFTVSAGKCTQGAYMQLLKVEETFTEELGFDFVLA   1471 - 1540
VDTEGLRAPEHSNKSKDRDNELVTFVIGLANLTLINIFGENPSEMQDILQIVVQAFLRMKQVKIFPSCLF   1541 - 1610
VHQNVGEATATDQTMDGRRRLEQKLDEMAAIAAEQEQCLDVTCFSDVIRFDVNTHVYYFAHLWDGNPPMA   1611 - 1680
PPNPRYSHNVQQLKSRILMTATQESRGNIMKISDVKSRVQDLWRGLMNENFIFSFRNTQEVMAMNKLETM   1681 - 1750
YNHWTWELRSHVLGLQNQLINQIQNGKIQTLEASTFEVLVTEKYEVVKQELEKYFNEGPCSKILIQCKAN   1751 - 1820
FENKLIVLKEKLISDSKRQANELISFKNQSQERLNKKKTDYEKELLEKSRKLALTVKGKELSEEELHEKF   1821 - 1890
NQLWKKWVCDVSTTLPQVTEPDIDLDSENILWEYFKNKTNVVGLLTNSAEKFQINYDKHIKVNKKYNHIP   1891 - 1960
MTLTVFEKEFINMTTDYIVSRFNKIINNMWKQQCGYNPNYFHEILKTIEEEVKSASTQKRYTFTNTFIID   1961 - 2030
LCVCLFQRARENFKEMHRAFKRANDPVNYLESKKDDFFTSFKISCQGATSIKTFVDVLWYKLTPAVSTTI   2031 - 2100
WEDMTFKIAGDMRATCPAFNGNRTNLEKHILFSLAEEENFDNYWEYLHNSKSFFRSYIKNHIKRYCSDNG   2101 - 2170
GEKMKTFFEKSLIDIKNTILSAIHESTSVAKDKSSTASEWLDLFCDCLGCNLIFPRRDLISIEHQEIKHT   2171 - 2240
EFLKEAMSAALDLTMKKIEQNYSSKPIEAMVSKIEKMLSEHLCGCWKQCPSCGAICTNTIPTHEGDHSVP   2241 - 2310
FHRPQAVNGEEWYETDDFVIDCCTSLVASDCLLVLRDGRNFPFKNYRQAGGDYAMWSITPDTSIQLYWKW   2311 - 2380
FVSHFRSNLEEKYQKKFAGKGKIPNAWAKITKQDVLEDLKKQ                               2381 - 2422
//

Text Mined References (5)

PMID Year Title
19369598 2009 The evolutionarily dynamic IFN-inducible GTPase proteins play conserved immune functions in vertebrates and cephalochordates.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12874213 2003 A giant GTPase, very large inducible GTPase-1, is inducible by IFNs.