Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.00
PubTator Score 3.07

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
facioscapulohumeral dystrophy 286 9.2632232271287E-7
ovarian cancer 8492 1.11615461766022E-5
osteosarcoma 7933 6.22594817928515E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0167170349990065
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0185375525103298
aldosterone-producing adenoma 664 0.0263102785329687
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0



Accession Q7Z2Y5 Q32ND6 Q5H9K2 Q6ZMP2
Symbols NESK



  Ortholog (7)

 Collection (1)

AA Sequence

KLRFLCTRGDKLFFTSTLRNHHSRVYFMTLGKLEELQSNYDV                               1541 - 1582

Text Mined References (12)

PMID Year Title
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16381901 2006 The LIFEdb database in 2006.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12837278 2003 Cofilin phosphorylation and actin polymerization by NRK/NESK, a member of the germinal center kinase family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.