Property Summary

NCBI Gene PubMed Count 7
Grant Count 539
R01 Count 176
Funding $117,822,785.41
PubMed Score 10.85
PubTator Score 10.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Placental abruption 15 3.58 1.8

Expression

Synonym

Accession Q7Z2X7 Q5JRK7 Q5JRK8 PAGE-2
Symbols CT16.4
GAGEC2
GAGEE2
PAGE-2

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
25229454 Epigenetic mechanisms underlying the dynamic expression of cancer-testis genes, PAGE2, -2B and SPANX-B, during mesenchymal-to-epithelial transition

AA Sequence

MSELLRARSQSSERGNDQESSQPVGSVIVQEPTEEKRQEEEPPTDNQGIAPSGEIENQAVPAFQGPDMEA      1 - 70
FQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDAQP                                  71 - 111
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25229454 2014 Epigenetic mechanisms underlying the dynamic expression of cancer-testis genes, PAGE2, -2B and SPANX-B, during mesenchymal-to-epithelial transition.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9724777 1998 PAGE-1, an X chromosome-linked GAGE-like gene that is expressed in normal and neoplastic prostate, testis, and uterus.