Property Summary

NCBI Gene PubMed Count 22
Grant Count 8
R01 Count 5
Funding $698,340.02
PubMed Score 58.11
PubTator Score 26.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -3.700 0.000
oligodendroglioma 1.400 0.036
psoriasis -1.700 0.002
group 4 medulloblastoma -2.600 0.000
cystic fibrosis 4.874 0.000
glioblastoma -1.600 0.008
atypical teratoid / rhabdoid tumor -2.200 0.006
medulloblastoma, large-cell -2.200 0.048
Atopic dermatitis -1.100 0.003
adrenocortical carcinoma -2.224 0.002
pancreatic ductal adenocarcinoma liver m... -3.372 0.000
tuberculosis and treatment for 6 months -1.200 0.046
non-small cell lung cancer -2.197 0.000
lung cancer -4.300 0.000
breast carcinoma -1.900 0.000
fibroadenoma -1.700 0.000
lung adenocarcinoma -1.600 0.000
pilocytic astrocytoma 1.300 0.001
invasive ductal carcinoma -3.700 0.000
non-inflammatory breast cancer -1.100 0.005
ductal carcinoma in situ -2.300 0.000
ovarian cancer -2.500 0.000

 GO Component (2)

Gene RIF (12)

PMID Text
24300787 Overall survival and radiation-free progression-free survival were longer in medulloblastoma patients whose tumors had higher PID1 mRNA levels.
23927930 Pid1 is a potent intracellular inhibitor of insulin signaling pathway during obesity in humans and mice.
23274913 overexpression of TFAM can restore mitochondrial function to normal levels in NYGGF4-overexpressing adipocytes
22968630 NYGGF4 plays a role in IR and its effects on IR could be reversed by metformin through activating IRS-1/PI3K/Akt and AMPK-PGC1-alpha pathways.
22284633 NYGGF4 acts directly on the IRS1/PI3K/AKT insulin pathway to reduce glucose uptake and transport, impairs mitochondrial function and causes insulin resistance, and thus may be a useful therapeutic target for obesity-associated insulin resistance.
20165904 Overexpression of NYGGF4 caused mitochondrial dysfunction in adipocytes, which might be responsible for the development of NYGGF4-induced insulin resistance.
20140872 TNFA up-regulated the expression of NYGGF4 during preadipocyte differentiation.
20010835 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19849947 NYGGF4 over-expression impairs the insulin sensitivity of 3T3-L1 adipocytes through decreasing GLUT4 translocation and had no effects on the secretory function of adipocytes.
19079291 Data show that NYGGF4 regulates the functions of IRS-1 and Akt, decreases GLUT4 translocation and reduces glucose uptake in response to insulin.
More...

AA Sequence

MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGTHFQTMLKSKLNVLTLKKEPLPAVIFHE      1 - 70
PEAIELCTTTPLMKTRTHSGCKVTYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRP     71 - 140
FQVWLHHLDHKGEATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKK    141 - 210
LAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG                                  211 - 250
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24300787 2014 PID1 (NYGGF4), a new growth-inhibitory gene in embryonal brain tumors and gliomas.
23927930 2013 Pid1 induces insulin resistance in both human and mouse skeletal muscle during obesity.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23274913 2013 Overexpression of TFAM protects 3T3-L1 adipocytes from NYGGF4 (PID1) overexpression-induced insulin resistance and mitochondrial dysfunction.
22968630 2012 NYGGF4 (PID1) effects on insulin resistance are reversed by metformin in 3T3-L1 adipocytes.
22284633 2012 NYGGF4 as a new therapeutic target for obesity-associated insulin resistance.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
20165904 2010 Overexpression of NYGGF4 (PID1) induces mitochondrial impairment in 3T3-L1 adipocytes.
20140872 2010 [Expression of the NYGGF4 gene during human preadipocyte differentiation and the regulative role of tumor necrosis factor-alpha].
More...