Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.40
PubTator Score 0.52

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7Z2W9 A6NKU0 C9JPR2 L21mt
Symbols L21mt
MRP-L21

Gene

PDB

3J9M   3J7Y  

Gene RIF (2)

PMID Text
26406417 High MRPL21 expression is associated with esophageal squamous cell carcinoma.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAASSLTVTLGRLASACSHSILRPSGPGAASLWSASRRFNSQSTSYLPGYVPKTSLSSPPWPEVVLPDPV      1 - 70
EETRHHAEVVKKVNEMIVTGQYGRLFAVVHFASRQWKVTSEDLILIGNELDLACGERIRLEKVLLVGADN     71 - 140
FTLLGKPLLGKDLVRVEATVIEKTESWPRIIMRFRKRKNFKKKRIVTTPQTVLRINSIEIAPCLL         141 - 205
//

Text Mined References (14)

PMID Year Title
26406417 2015 Identification of genomic biomarkers associated with the clinicopathological parameters and prognosis of esophageal squamous cell carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...