Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.40
PubTator Score 0.52

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MAASSLTVTLGRLASACSHSILRPSGPGAASLWSASRRFNSQSTSYLPGYVPKTSLSSPPWPEVVLPDPV      1 - 70
EETRHHAEVVKKVNEMIVTGQYGRLFAVVHFASRQWKVTSEDLILIGNELDLACGERIRLEKVLLVGADN     71 - 140
FTLLGKPLLGKDLVRVEATVIEKTESWPRIIMRFRKRKNFKKKRIVTTPQTVLRINSIEIAPCLL         141 - 205
//

Text Mined References (15)

PMID Year Title