Property Summary

NCBI Gene PubMed Count 109
Grant Count 112
R01 Count 67
Funding $19,498,558.94
PubMed Score 404.68
PubTator Score 287.67

Knowledge Summary

Patent (31,418)

Expression

  Differential Expression (5)

Synonym

Accession Q7Z2W7 A0AVG2 Q3YFM7 Q6QNH9 Q8TAC3 Q8TDX8 Q9BVK1
Symbols TRPP8
LTRPC6

Gene

PANTHER Protein Class (2)

 GO Function (1)

Gene RIF (97)

PMID Text
27038374 Translational and clinical investigation to exploit TRPM8 as a molecular biomarker and therapeutic target is expected to make a positive impact on precision medicine in pancreatic cancer and other malignant diseases.
26653082 These results are the first to show that menthol directly binds to the TRPM8 sensing domain.
26645885 The effects of specific agents on TRPV1 and TRPM8 channels are intricately interrelated.
26629685 The data of this study provided evidence for decreased activity and expression level of TRPM8 in the presence of methylglyoxal.
26536261 Study used a combination of molecular modeling and experimental techniques to examine the structure of the TRPM8 transmembrane and pore helix region including the conducting conformation of the selectivity filter
26330615 Several TRPM8 variants appeared to be poorly expressed in transfected HEK293 cells compared with non-mutated TRPM8.
26272603 The GC variant of the TRPM8: c.750G > C (rs11562975) polymorphism is associated with cold-induced airway hyperresponsiveness in patients with bronchial asthma.
26242276 Antibodies against TRPM8 are not found in scleroderma patient sera, suggesting that the abnormal cold sensitivity and associated abnormal vascular reactivity in scleroderma patients is not the result of an immune process targeting TRPM8.
26163239 TRPM8 underlines the important physiologic role of the nose in temperature regulation, both in patients with allergy and those without allergy. Isometric contraction studies demonstrate the role of TRPM8 in regulating nasal patency and airway resistance.
26080404 developed a new functional knockout mouse strain by deleting the pore domain of TRPM8 and demonstrated that eTRPM8 knockout impairs adaptation of the epidermis to low temperatures
More...

AA Sequence

MSFRAARLSMRNRRNDTLDSTRTLYSSASRSTDLSYSESDLVNFIQANFKKRECVFFTKDSKATENVCKC      1 - 70
GYAQSQHMEGTQINQSEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRLSCDTDAEILYELLTQHWHLK     71 - 140
TPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWILTGGTHYGLMKYIGEVVRDNTISRSSEENIV    141 - 210
AIGIAAWGMVSNRDTLIRNCDAEGYFLAQYLMDDFTRDPLYILDNNHTHLLLVDNGCHGHPTVEAKLRNQ    211 - 280
LEKYISERTIQDSNYGGKIPIVCFAQGGGKETLKAINTSIKNKIPCVVVEGSGQIADVIASLVEVEDALT    281 - 350
SSAVKEKLVRFLPRTVSRLPEEETESWIKWLKEILECSHLLTVIKMEEAGDEIVSNAISYALYKAFSTSE    351 - 420
QDKDNWNGQLKLLLEWNQLDLANDEIFTNDRRWESADLQEVMFTALIKDRPKFVRLFLENGLNLRKFLTH    421 - 490
DVLTELFSNHFSTLVYRNLQIAKNSYNDALLTFVWKLVANFRRGFRKEDRNGRDEMDIELHDVSPITRHP    491 - 560
LQALFIWAILQNKKELSKVIWEQTRGCTLAALGASKLLKTLAKVKNDINAAGESEELANEYETRAVELFT    561 - 630
ECYSSDEDLAEQLLVYSCEAWGGSNCLELAVEATDQHFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLF    631 - 700
IIPLVGCGFVSFRKKPVDKHKKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFAYVLLMDFHSVPHPPELV    701 - 770
LYSLVFVLFCDEVRQWYVNGVNYFTDLWNVMDTLGLFYFIAGIVFRLHSSNKSSLYSGRVIFCLDYIIFT    771 - 840
LRLIHIFTVSRNLGPKIIMLQRMLIDVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIFRSVIYEPYLA    841 - 910
MFGQVPSDVDGTTYDFAHCTFTGNESKPLCVELDEHNLPRFPEWITIPLVCIYMLSTNILLVNLLVAMFG    911 - 980
YTVGTVQENNDQVWKFQRYFLVQEYCSRLNIPFPFIVFAYFYMVVKKCFKCCCKEKNMESSVCCFKNEDN    981 - 1050
ETLAWEGVMKENYLVKINTKANDTSEEMRHRFRQLDTKLNDLKGLLKEIANKIK                   1051 - 1104
//

Text Mined References (110)

PMID Year Title
27038374 2016 TRPM8 Ion Channels as Potential Cancer Biomarker and Target in Pancreatic Cancer.
26653082 2016 Implications of Human Transient Receptor Potential Melastatin 8 (TRPM8) Channel Gating from Menthol Binding Studies of the Sensing Domain.
26645885 2016 Reciprocal effects of capsaicin and menthol on thermosensation through regulated activities of TRPV1 and TRPM8.
26629685 2016 Glycolytic metabolite methylglyoxal inhibits cold and menthol activation of the transient receptor potential melastatin type 8 channel.
26536261 2015 Functional and Modeling Studies of the Transmembrane Region of the TRPM8 Channel.
26330615 2015 Genetic variants affecting human TRPA1 or TRPM8 structure can be classified in vitro as 'well expressed', 'poorly expressed' or 'salvageable'.
26272603 2015 Transient receptor potential melastatin 8 gene polymorphism is associated with cold-induced airway hyperresponsiveness in bronchial asthma.
26242276 Pilot study to determine whether transient receptor potential melastatin type 8 (TRPM8) antibodies are detected in scleroderma.
26163239 Identification of the cold receptor TRPM8 in the nasal mucosa.
26080404 2015 Epidermal TRPM8 channel isoform controls the balance between keratinocyte proliferation and differentiation in a cold-dependent manner.
More...