Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.91
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 1.1e-03
gastric cancer 1.200 9.8e-03
glioblastoma -1.500 9.7e-04
group 3 medulloblastoma 1.100 2.3e-02
hepatocellular carcinoma 1.500 6.9e-04
intraductal papillary-mucinous adenoma (... 1.100 1.2e-02
medulloblastoma, large-cell -1.300 5.1e-04
osteosarcoma -2.411 6.8e-07
ovarian cancer -2.000 2.3e-05
pancreatic cancer 1.300 1.3e-02
pancreatic carcinoma 1.300 1.3e-02
tuberculosis -1.100 2.0e-02

Gene RIF (4)

AA Sequence

MENMAEEELLPLEKEEVEVAQVQVPTPARDSAGVPAPAPDSALDSAPTPASAPAPAPALAQAPALSPSLA      1 - 70
SAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNSDNLDAGNRQACPLCPKEKFRACNSHKLRRH     71 - 140
LQNLHWKVSVEFEGYRMCICHLPCRPVKPNIIGEQITSKMGAHYHCIICSATITRRTDMLGHVRRHMNKG    141 - 210
ETKSSYIAASTAKPPKEILKEADTDVQVCPNYSIPQKTDSYFNPKMKLNRQLIFCTLAALAEERKPLECL    211 - 280
DAFGATGIMGLQWAKHLGNAVKVTINDLNENSVTLIQENCHLNKLKVVVDSKEKEKSDDILEEGEKNLGN    281 - 350
IKVTKMDANVLMHLRSFDFIHLDPFGTSVNYLDSAFRNIRNLGIVSVTSTDISSLYAKAQHVARRHYGCN    351 - 420
IVRTEYYKELAARIVVAAVARAAARCNKGIEVLFAVALEHFVLVVVRVLRGPTSADETAKKIQYLIHCQW    421 - 490
CEERIFQKDGNMVEENPYRQLPCNCHGSMPGKTAIELGPLWSSSLFNTGFLKRMLFESLHHGLDDIQTLI    491 - 560
KTLIFESECTPQSQFSIHASSNVNKQEENGVFIKTTDDTTTDNYIAQGKRKSNEMITNLGKKQKTDVSTE    561 - 630
HPPFYYNIHRHSIKGMNMPKLKKFLCYLSQAGFRVSRTHFDPMGVRTDAPLMQFKSILLKYSTPTYTGGQ    631 - 700
SESHVQSASEDTVTERVEMSVNDKAEASGCRRW                                         701 - 733
//

Text Mined References (14)

PMID Year Title