Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.91
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 6.77680297177504E-7
ovarian cancer 8492 2.32917331022737E-5
medulloblastoma, large-cell 6234 5.11746754149429E-4
tuberculosis and treatment for 6 months 686 6.78513887514692E-4
hepatocellular carcinoma 550 6.94850829537809E-4
glioblastoma 5572 9.6772673171685E-4
atypical teratoid / rhabdoid tumor 4369 0.00105838561946545
gastric cancer 436 0.0097831840380987
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0118236501274416
pancreatic cancer 2300 0.0134463989656479
pancreatic carcinoma 567 0.0134463989656479
group 3 medulloblastoma 2254 0.0229678453767019

Expression

  Differential Expression (12)

Synonym

Accession Q7Z2T5 Q5TEN0 Q6ZMX0 Q8IWH5 Q8NC68 Q9BZQ1
Symbols TRM1L
MST070
C1orf25
MSTP070
bG120K12.3

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (4)

PMID Text
25010285 Interaction of HIV-1 Gag with tRNA methyltransferase 1 homolog (S. cerevisiae)-like (TRMT1L) is identified in a series of six affinity purification/mass spectrometry screens
22174317 Interaction of HIV-1 Gag with tRNA methyltransferase 1 homolog (S. cerevisiae)-like (TRMT1L) is identified in a series of six affinity purification/mass spectrometry screens
17198746 Functional characterization of the mouse C1orf25 ortholog and comparison to the human protein.
11318611 Includes the identification of the C1orf25 gene.

AA Sequence

MENMAEEELLPLEKEEVEVAQVQVPTPARDSAGVPAPAPDSALDSAPTPASAPAPAPALAQAPALSPSLA      1 - 70
SAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNSDNLDAGNRQACPLCPKEKFRACNSHKLRRH     71 - 140
LQNLHWKVSVEFEGYRMCICHLPCRPVKPNIIGEQITSKMGAHYHCIICSATITRRTDMLGHVRRHMNKG    141 - 210
ETKSSYIAASTAKPPKEILKEADTDVQVCPNYSIPQKTDSYFNPKMKLNRQLIFCTLAALAEERKPLECL    211 - 280
DAFGATGIMGLQWAKHLGNAVKVTINDLNENSVTLIQENCHLNKLKVVVDSKEKEKSDDILEEGEKNLGN    281 - 350
IKVTKMDANVLMHLRSFDFIHLDPFGTSVNYLDSAFRNIRNLGIVSVTSTDISSLYAKAQHVARRHYGCN    351 - 420
IVRTEYYKELAARIVVAAVARAAARCNKGIEVLFAVALEHFVLVVVRVLRGPTSADETAKKIQYLIHCQW    421 - 490
CEERIFQKDGNMVEENPYRQLPCNCHGSMPGKTAIELGPLWSSSLFNTGFLKRMLFESLHHGLDDIQTLI    491 - 560
KTLIFESECTPQSQFSIHASSNVNKQEENGVFIKTTDDTTTDNYIAQGKRKSNEMITNLGKKQKTDVSTE    561 - 630
HPPFYYNIHRHSIKGMNMPKLKKFLCYLSQAGFRVSRTHFDPMGVRTDAPLMQFKSILLKYSTPTYTGGQ    631 - 700
SESHVQSASEDTVTERVEMSVNDKAEASGCRRW                                         701 - 733
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17198746 2007 The mouse Trm1-like gene is expressed in neural tissues and plays a role in motor coordination and exploratory behaviour.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...