Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.91
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (4)

PMID Text
25010285 Interaction of HIV-1 Gag with tRNA methyltransferase 1 homolog (S. cerevisiae)-like (TRMT1L) is identified in a series of six affinity purification/mass spectrometry screens
22174317 Interaction of HIV-1 Gag with tRNA methyltransferase 1 homolog (S. cerevisiae)-like (TRMT1L) is identified in a series of six affinity purification/mass spectrometry screens
17198746 Functional characterization of the mouse C1orf25 ortholog and comparison to the human protein.
11318611 Includes the identification of the C1orf25 gene.

AA Sequence

MENMAEEELLPLEKEEVEVAQVQVPTPARDSAGVPAPAPDSALDSAPTPASAPAPAPALAQAPALSPSLA      1 - 70
SAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNSDNLDAGNRQACPLCPKEKFRACNSHKLRRH     71 - 140
LQNLHWKVSVEFEGYRMCICHLPCRPVKPNIIGEQITSKMGAHYHCIICSATITRRTDMLGHVRRHMNKG    141 - 210
ETKSSYIAASTAKPPKEILKEADTDVQVCPNYSIPQKTDSYFNPKMKLNRQLIFCTLAALAEERKPLECL    211 - 280
DAFGATGIMGLQWAKHLGNAVKVTINDLNENSVTLIQENCHLNKLKVVVDSKEKEKSDDILEEGEKNLGN    281 - 350
IKVTKMDANVLMHLRSFDFIHLDPFGTSVNYLDSAFRNIRNLGIVSVTSTDISSLYAKAQHVARRHYGCN    351 - 420
IVRTEYYKELAARIVVAAVARAAARCNKGIEVLFAVALEHFVLVVVRVLRGPTSADETAKKIQYLIHCQW    421 - 490
CEERIFQKDGNMVEENPYRQLPCNCHGSMPGKTAIELGPLWSSSLFNTGFLKRMLFESLHHGLDDIQTLI    491 - 560
KTLIFESECTPQSQFSIHASSNVNKQEENGVFIKTTDDTTTDNYIAQGKRKSNEMITNLGKKQKTDVSTE    561 - 630
HPPFYYNIHRHSIKGMNMPKLKKFLCYLSQAGFRVSRTHFDPMGVRTDAPLMQFKSILLKYSTPTYTGGQ    631 - 700
SESHVQSASEDTVTERVEMSVNDKAEASGCRRW                                         701 - 733
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17198746 2007 The mouse Trm1-like gene is expressed in neural tissues and plays a role in motor coordination and exploratory behaviour.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...