Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.50
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Synonym

Accession Q7Z2Q7 Q6ZWI5
Symbols SLRN

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
12767927 Synleurin, a novel leucine-rich repeat protein that increases the intensity of pleiotropic cytokine and growth factor responses.

AA Sequence

MCGLQFSLPCLRLFLVVTCYLLLLLHKEILGCSSVCQLCTGRQINCRNLGLSSIPKNFPESTVFLYLTGN      1 - 70
NISYINESELTGLHSLVALYLDNSNILYVYPKAFVQLRHLYFLFLNNNFIKRLDPGIFKGLLNLRNLYLQ     71 - 140
YNQVSFVPRGVFNDLVSVQYLNLQRNRLTVLGSGTFVGMVALRILDLSNNNILRISESGFQHLENLACLY    141 - 210
LGSNNLTKVPSNAFEVLKSLRRLSLSHNPIEAIQPFAFKGLANLEYLLLKNSRIRNVTRDGFSGINNLKH    211 - 280
LILSHNDLENLNSDTFSLLKNLIYLKLDRNRIISIDNDTFENMGASLKILNLSFNNLTALHPRVLKPLSS    281 - 350
LIHLQANSNPWECNCKLLGLRDWLASSAITLNIYCQNPPSMRGRALRYINITNCVTSSINVSRAWAVVKS    351 - 420
PHIHHKTTALMMAWHKVTTNGSPLENTETENITFWERIPTSPAGRFFQENAFGNPLETTAVLPVQIQLTT    421 - 490
SVTLNLEKNSALPNDAASMSGKTSLICTQEVEKLNEAFDILLAFFILACVLIIFLIYKVVQFKQKLKASE    491 - 560
NSRENRLEYYSFYQSARYNVTASICNTSPNSLESPGLEQIRLHKQIVPENEAQVILFEHSAL            561 - 622
//

Text Mined References (5)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12767927 2003 Synleurin, a novel leucine-rich repeat protein that increases the intensity of pleiotropic cytokine responses.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.