Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.71
PubTator Score 3.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.45697288685875E-61
posterior fossa group B ependymoma 1530 3.6884755767089E-13
atypical teratoid/rhabdoid tumor 1095 2.09947646688281E-5
group 4 medulloblastoma 1875 0.00228189025489353
adult high grade glioma 2148 0.00506206405520235
subependymal giant cell astrocytoma 2287 0.037616590013954
Disease Target Count Z-score Confidence
pustulosis of palm and sole 5 3.991 2.0

Expression

  Differential Expression (6)

Synonym

Accession Q7Z2K8 C9JM70 Q8ND74 Q96PZ4 GRIN1
Symbols GRIN1

Gene

  Ortholog (4)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG

AA Sequence

MDTAEDPAWLQLLQKDSSPPGPRPTAFFCPQDGSLGAGSSAMRDYCPSQQKASPAPPRHTPDQSPGMESR      1 - 70
HRSPSGAGEGASCSDGPRGSLACPSPTCFSPQESPSKETLEAHGASISGTPEATTSGKPEPVSSVKTEPK     71 - 140
SSDDRNPMFLEKMDFKSSKQADSTSIGKEDPGSSRKADPMFTGKAEPEILGKGDPVAPGRMDPMTVRKED    141 - 210
LGSLGKVDPLCSSKTYTVSPRKEDPGSLRKVDPVSSDKVDPVFPRKEEPRYSGKEHPVSSEKVAPTSAEK    211 - 280
VDLVLSGKRDPGPSGKADPMPLESMDSASTGKTEPGLLGKLIPGSSGKNGPVSSGTGAPGSLGRLDPTCL    281 - 350
GMADPASVGNVETVPATKEDSRFLGKMDPASSGEGRPVSGHTDTTASAKTDLTSLKNVDPMSSGKVDPVS    351 - 420
LGKMDPMCSGKPELLSPGQAERVSVGKAGTVSPGKEDPVSSRREDPISAGSRKTSSEKVNPESSGKTNPV    421 - 490
SSGPGDPRSLGTAGPPSAVKAEPATGGKGDPLSSEKAGLVASGKAAPTASGKAEPLAVGKEDPVSKGKAD    491 - 560
AGPSGQGDSVSIGKVVSTPGKTVPVPSGKVDPVSLGKAEAIPEGKVGSLPLEKGSPVTTTKADPRASGKA    561 - 630
QPQSGGKAETKLPGQEGAAAPGEAGAVCLKKETPQASEKVDPGSCRKAEPLASGKGEPVSLGKADSAPSR    631 - 700
KTESPSLGKVVPLSLEKTKPSSSSRQLDRKALGSARSPEGARGSEGRVEPKAEPVSSTEASSLGQKDLEA    701 - 770
AGAERSPCPEAAAPPPGPRTRDNFTKAPSWEASAPPPPREDAGTQAGAQACVSVAVSPMSPQDGAGGSAF    771 - 840
SFQAAPRAPSPPSRRDAGLQVSLGAAETRSVATGPMTPQAAAPPAFPEVRVRPGSALAAAVAPPEPAEPV    841 - 910
RDVSWDEKGMTWEVYGAAMEVEVLGMAIQKHLERQIEEHGRQGAPAPPPAARAGPGRSGSVRTAPPDGAA    911 - 980
KRPPGLFRALLQSVRRPRCCSRAGPTAE                                              981 - 1008
//

Text Mined References (9)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488195 2004 Identification and biochemical analysis of GRIN1 and GRIN2.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.
10480904 1999 A candidate target for G protein action in brain.