Property Summary

NCBI Gene PubMed Count 40
PubMed Score 28.81
PubTator Score 57.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 2.200 0.000
osteosarcoma -2.131 0.000
posterior fossa group B ependymoma -1.400 0.000
group 4 medulloblastoma -1.900 0.000
medulloblastoma, large-cell -1.900 0.000
ulcerative colitis -1.600 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q7Z2H8 C9JI34 Q1LZ56 Q7Z7C0 Q86YK4 Q96M74 Proton/amino acid transporter 1
Symbols Dct1
PAT1
LYAAT1
TRAMD3

Gene

PANTHER Protein Class (2)

Gene RIF (15)

PMID Text
23962042 Sertraline is an apparent non-competitive inhibitor of PAT1-mediated transport.
23488788 Data suggest that PAT1 in enterocytes is responsible for intestinal absorption of some of the alkaloids from areca nut (i.e., arecaidine, guvacine, isoguvacine).
22975709 estrogen attenuates the activity of PAT1 by directly closing PAT1
22853447 In hPAT1 expressing oocytes Gly-Tyr, Gly-Pro, and Gly-Phe inhibited currents induced by drug substances.
22574197 PATs function as part of an amino acid-sensing engine that drives mTORC1 activation from endosomal and lysosomal membranes
20498635 In human cells, SLC36A1 localized on intracellular membranes is required for amino acid-dependent mTORC1 activation and cell proliferation. SLC36A1 also has similar in vivo growth regulatory activity to fly SLC36 AAAPs when expressed in Drosophila.
19549785 a disulfide bridge is essential for the transport function of the human proton-coupled amino acid transporter hPAT1
19409386 The role of N-glycosylation in transport function and surface targeting of the human solute carrier PAT1
19358571 Data conclude that hPAT1 might be responsible for the intestinal absorption of beta-GPA thereby allowing its oral administration.
19074966 This study is the first to demonstrate both taurine uptake via PAT1 and functional expression of PAT1 at the apical membrane of the intestinal epithelium.
More...

AA Sequence

MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQTLIHLLKGNIGTGLLGLPL      1 - 70
AVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRRLNKSFVDYGDTVMYGLESSPCSWLRNHAHWGR     71 - 140
RVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNCHNNETVILTPTMDSRLYMLSFLPFLVLLVF    141 - 210
IRNLRALSIFSLLANITMLVSLVMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLEN    211 - 280
KMKDPRKFPLILYLGMVIVTILYISLGCLGYLQFGANIQGSITLNLPNCWLYQSVKLLYSIGIFFTYALQ    281 - 350
FYVPAEIIIPFFVSRAPEHCELVVDLFVRTVLVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLE    351 - 420
VTTFYSEGMSPLTIFKDALISILGFVGFVVGTYEALYELIQPSNAPIFINSTCAFI                  421 - 476
//

Text Mined References (43)

PMID Year Title
25880931 2015 PAT1 inversely regulates the surface Amyloid Precursor Protein level in mouse primary neurons.
25534429 2015 Human intestine luminal ACE2 and amino acid transporter expression increased by ACE-inhibitors.
25450364 2014 Effect of 5-aminolevulinic acid on erythropoiesis: a preclinical in vitro characterization for the treatment of congenital sideroblastic anemia.
25337649 2014 Pharmacokinetic aspects of the anti-epileptic drug substance vigabatrin: focus on transporter interactions.
25193853 2014 Mutational analysis of genes coding for cell surface proteins in colorectal cancer cell lines reveal novel altered pathways, druggable mutations and mutated epitopes for targeted therapy.
25117815 2014 Identification of 33 candidate oncogenes by screening for base-specific mutations.
25062867 2014 The anti-epileptic drug substance vigabatrin inhibits taurine transport in intestinal and renal cell culture models.
24760501 2014 Insulin increases mRNA abundance of the amino acid transporter SLC7A5/LAT1 via an mTORC1-dependent mechanism in skeletal muscle cells.
23962042 2013 Sertraline inhibits the transport of PAT1 substrates in vivo and in vitro.
23506890 Evolutionary origin of amino acid transporter families SLC32, SLC36 and SLC38 and physiological, pathological and therapeutic aspects.
More...