Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.32
PubTator Score 6.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Male infertility 170 4.182 2.1

Synonym

Accession Q7Z2G1 B1AK72 Q147W3
Symbols

Gene

 GO Function (1)

 GO Process (1)

Gene RIF (2)

PMID Text
22509975 Data indicate that the polymorphism -9C>T and 368A>G in H2BFWT gene are associated with male infertility with idiopathic azoospermia or oligozoospermia, suggesting susceptibility of H2BFWT gene to spermatogenesis impairment in Chinese population.
19583817 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLRTEVPRLPRSTTAIVWSCHLMATASAMAGPSSETTSEEQLITQEPKEANSTTSQKQSKQRKRGRHGPR      1 - 70
RCHSNCRGDSFATYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATEAGRLARSTKRQTITAWETRM     71 - 140
AVRLLLPGQMGKLAESEGTKAVLRTSLYAIQQQRK                                       141 - 175
//

Text Mined References (10)

PMID Year Title
25731851 2015 Nucleosome adaptability conferred by sequence and structural variations in histone H2A-H2B dimers.
24614311 2014 Every amino acid matters: essential contributions of histone variants to mammalian development and disease.
22509975 2012 Relationship of SNP of H2BFWT gene to male infertility in a Chinese population with idiopathic spermatogenesis impairment.
19583817 2009 Functional polymorphism in H2BFWT-5'UTR is associated with susceptibility to male infertility.
16449661 2006 The NH2 tail of the novel histone variant H2BFWT exhibits properties distinct from conventional H2B with respect to the assembly of mitotic chromosomes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15475252 2004 Novel human testis-specific histone H2B encoded by the interrupted gene on the X chromosome.
15237208 2004 Male germline-specific histones in mouse and man.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.