Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.12
PubTator Score 6.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Male infertility 206 4.603 2.3

Gene RIF (2)

AA Sequence

MLRTEVPRLPRSTTAIVWSCHLMATASAMAGPSSETTSEEQLITQEPKEANSTTSQKQSKQRKRGRHGPR      1 - 70
RCHSNCRGDSFATYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATEAGRLARSTKRQTITAWETRM     71 - 140
AVRLLLPGQMGKLAESEGTKAVLRTSLYAIQQQRK                                       141 - 175
//

Text Mined References (10)

PMID Year Title