Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma 1.200 3.0e-03
intraductal papillary-mucinous carcinoma... 1.200 2.8e-02
medulloblastoma, large-cell -1.100 4.4e-03
ovarian cancer 1.800 2.1e-05

Gene RIF (1)

AA Sequence

MGLLTFRDVAIEFSREEWEHLDSDQKLLYGDVMLENYGNLVSLGLAVSKPDLITFLEQRKEPWNVKSAET      1 - 70
VAIQPDIFSHDTQGLLRKKLIEASFQKVILDGYGSCGPQNLNLRKEWESEGKIILW                   71 - 126
//

Text Mined References (5)

PMID Year Title