Property Summary

NCBI Gene PubMed Count 66
PubMed Score 111.55
PubTator Score 117.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
ovarian cancer 8520 8.5e-07
tuberculosis and treatment for 6 months 409 1.2e-04
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 4.327 2.2

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.500 8.5e-07
tuberculosis and treatment for 6 months -1.100 1.2e-04

Protein-protein Interaction (2)

Gene RIF (40)

AA Sequence

MSNVNLSVSDFWRVMMRVCWLVRQDSRHQRIRLPHLEAVVIGRGPETKITDKKCSRQQVQLKAECNKGYV      1 - 70
KVKQVGVNPTSIDSVVIGKDQEVKLQPGQVLHMVNELYPYIVEFEEEAKNPGLETHRKRKRSGNSDSIER     71 - 140
DAAQEAEAGTGLEPGSNSGQCSVPLKKGKDAPIKKESLGHWSQGLKISMQDPKMQVYKDEQVVVIKDKYP    141 - 210
KARYHWLVLPWTSISSLKAVAREHLELLKHMHTVGEKVIVDFAGSSKLRFRLGYHAIPSMSHVHLHVISQ    211 - 280
DFDSPCLKNKKHWNSFNTEYFLESQAVIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHL    281 - 350
RKHWTQ                                                                    351 - 356
//

Text Mined References (67)

PMID Year Title