Property Summary

NCBI Gene PubMed Count 8
PubMed Score 13.40
PubTator Score 10.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
astrocytoma 1493 4.96220168086316E-18
oligodendroglioma 2849 8.66153394576301E-17
posterior fossa group A ependymoma 1511 4.51952046614264E-13
interstitial cystitis 2299 6.81361546075482E-8
cystic fibrosis 1670 1.25102344903858E-7
sonic hedgehog group medulloblastoma 1482 2.56283751867105E-6
glioblastoma 5572 3.51665007640611E-4
atypical teratoid / rhabdoid tumor 4369 4.34323594082229E-4
pediatric high grade glioma 2712 0.00104168694166959
primitive neuroectodermal tumor 3031 0.00158543052903642
ovarian cancer 8492 0.00445341869654558
psoriasis 6685 0.00494891613056319
Parkinson's disease 364 0.00947128665301152
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0110624992909181
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0144968913098831
interstitial lung disease 292 0.0317706802428621
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q7Z2D5 E7EPS1 O75043 Q5T9R9 Q86XQ5 Q8N3F1 Q96MP0
Symbols LPR4
PHP1
PRG1
LPPR4
PRG-1

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG

Gene RIF (2)

PMID Text
20381006 LPR4 mutations alter Wnt/beta catenin signaling and cause limb and kidney malformations in Cenani-Lenz syndrome.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MQRAGSSGGRGECDISGAGRLGLEEAARLSCAVHTSPGGGRRPGQAAGMSAKERPKGKVIKDSVTLLPCF      1 - 70
YFVELPILASSVVSLYFLELTDVFKPVHSGFSCYDRSLSMPYIEPTQEAIPFLMLLSLAFAGPAITIMVG     71 - 140
EGILYCCLSKRRNGVGLEPNINAGGCNFNSFLRRAVRFVGVHVFGLCSTALITDIIQLSTGYQAPYFLTV    141 - 210
CKPNYTSLNVSCKENSYIVEDICSGSDLTVINSGRKSFPSQHATLAAFAAVYVSMYFNSTLTDSSKLLKP    211 - 280
LLVFTFIICGIICGLTRITQYKNHPVDVYCGFLIGGGIALYLGLYAVGNFLPSDESMFQHRDALRSLTDL    281 - 350
NQDPNRLLSAKNGSSSDGIAHTEGILNRNHRDASSLTNLKRANADVEIITPRSPMGKENMVTFSNTLPRA    351 - 420
NTPSVEDPVRRNASIHASMDSARSKQLLTQWKNKNESRKLSLQVIEPEPGQSPPRSIEMRSSSEPSRVGV    421 - 490
NGDHHGPGNQYLKIQPGAVPGCNNSMPGGPRVSIQSRPGSSQLVHIPEETQENISTSPKSSSARAKWLKA    491 - 560
AEKTVACNRSNSQPRIMQVIAMSKQQGVLQSSPKNTEGSTVSCTGSIRYKTLTDHEPSGIVRVEAHPENN    561 - 630
RPIIQIPSTEGEGSGSWKWKAPEKGSLRQTYELNDLNRDSESCESLKDSFGSGDRKRSNIDSNEHHHHGI    631 - 700
TTIRVTPVEGSEIGSETLSISSSRDSTLRRKGNIILIPERSNSPENTRNIFYKGTSPTRAYKD           701 - 763
//

Text Mined References (11)

PMID Year Title
23213074 2013 Association between liver-specific gene polymorphisms and their expression levels with nonalcoholic fatty liver disease.
20381006 2010 LRP4 mutations alter Wnt/beta-catenin signaling and cause limb and kidney malformations in Cenani-Lenz syndrome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19766573 2009 Synaptic PRG-1 modulates excitatory transmission via lipid phosphate-mediated signaling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12730698 2003 A new phospholipid phosphatase, PRG-1, is involved in axon growth and regenerative sprouting.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12069809 2002 Roles for lipid phosphate phosphatases in regulation of cellular signaling.
More...