Property Summary

NCBI Gene PubMed Count 8
PubMed Score 13.65
PubTator Score 10.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.700 2.9e-02
astrocytic glioma -2.300 1.2e-03
atypical teratoid / rhabdoid tumor -4.000 4.3e-04
cystic fibrosis -4.948 1.3e-07
ependymoma -3.800 2.2e-02
glioblastoma -2.300 3.5e-04
group 4 medulloblastoma 1.800 1.4e-02
interstitial cystitis -3.800 1.9e-05
interstitial lung disease 1.200 3.2e-02
intraductal papillary-mucinous adenoma (... -1.400 1.1e-02
intraductal papillary-mucinous carcinoma... -1.400 1.4e-02
oligodendroglioma -2.300 4.5e-03
ovarian cancer -1.300 1.3e-04
Parkinson's disease -1.600 9.5e-03
primitive neuroectodermal tumor -2.100 1.6e-03
psoriasis -1.200 4.9e-03

Gene RIF (2)

AA Sequence

MQRAGSSGGRGECDISGAGRLGLEEAARLSCAVHTSPGGGRRPGQAAGMSAKERPKGKVIKDSVTLLPCF      1 - 70
YFVELPILASSVVSLYFLELTDVFKPVHSGFSCYDRSLSMPYIEPTQEAIPFLMLLSLAFAGPAITIMVG     71 - 140
EGILYCCLSKRRNGVGLEPNINAGGCNFNSFLRRAVRFVGVHVFGLCSTALITDIIQLSTGYQAPYFLTV    141 - 210
CKPNYTSLNVSCKENSYIVEDICSGSDLTVINSGRKSFPSQHATLAAFAAVYVSMYFNSTLTDSSKLLKP    211 - 280
LLVFTFIICGIICGLTRITQYKNHPVDVYCGFLIGGGIALYLGLYAVGNFLPSDESMFQHRDALRSLTDL    281 - 350
NQDPNRLLSAKNGSSSDGIAHTEGILNRNHRDASSLTNLKRANADVEIITPRSPMGKENMVTFSNTLPRA    351 - 420
NTPSVEDPVRRNASIHASMDSARSKQLLTQWKNKNESRKLSLQVIEPEPGQSPPRSIEMRSSSEPSRVGV    421 - 490
NGDHHGPGNQYLKIQPGAVPGCNNSMPGGPRVSIQSRPGSSQLVHIPEETQENISTSPKSSSARAKWLKA    491 - 560
AEKTVACNRSNSQPRIMQVIAMSKQQGVLQSSPKNTEGSTVSCTGSIRYKTLTDHEPSGIVRVEAHPENN    561 - 630
RPIIQIPSTEGEGSGSWKWKAPEKGSLRQTYELNDLNRDSESCESLKDSFGSGDRKRSNIDSNEHHHHGI    631 - 700
TTIRVTPVEGSEIGSETLSISSSRDSTLRRKGNIILIPERSNSPENTRNIFYKGTSPTRAYKD           701 - 763
//

Text Mined References (11)

PMID Year Title