Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 3.47799899682246E-19
non-small cell lung carcinoma 413 2.29535200659991E-18
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.200 0.000
non-small cell lung carcinoma -1.200 0.000

Synonym

Accession Q7RTY7
Symbols OVCH

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Xenopus OMA EggNOG

AA Sequence

MGLLASAGLLLLLVIGHPRSLGLKCGIRMVNMKSKEPAVGSRFFSRISSWRNSTVTGHPWQVSLKSDEHH      1 - 70
FCGGSLIQEDRVVTAAHCLDSLSEKQLKNITVTSGEYSLFQKDKQEQNIPVSKIITHPEYNSREYMSPDI     71 - 140
ALLYLKHKVKFGNAVQPICLPDSDDKVEPGILCLSSGWGKISKTSEYSNVLQEMELPIMDDRACNTVLKS    141 - 210
MNLPPLGRTMLCAGFPDWGMDACQGDSGGPLVCRRGGGIWILAGITSWVAGCAGGSVPVRNNHVKASLGI    211 - 280
FSKVSELMDFITQNLFTGLDRGQPLSKVGSRYITKALSSVQEVNGSQRGKGILDMEKQVGCDHDYVSLRS    281 - 350
SSGVLFNQRSLMEDDGKQNKRVCGKILPSPLLAETSEAMVPFVSDTEDSGSGFELTVTAVQKSEAGSGCG    351 - 420
SLAILVEEGTNHSAKYPDLYPSNIRCHWFICAPEKHIIKLTFEDFAVKFSPNCIYDAVVIYGDSEEKHKL    421 - 490
AKLCGMLTITSIFSSSNMTVIYFKSDGKNRLQGFKARFTILPSESLNKFEPKLPPQNNPVSTVKAILHDV    491 - 560
CGIPPFSPQWLSRRIAGGEEACPHCWPWQVGLRFLGDYQCGGAIINPVWILTAAHCVQLKNNPLSWTIIA    561 - 630
GDHDRNLKESTEQVRRAKHIIVHEDFNTLSYDSDIALIQLSSPLEYNSVVRPVCLPHSAEPLFSSEICAV    631 - 700
TGWGSISADGGLASRLQQIQVHVLEREVCEHTYYSAHPGGITEKMICAGFAASGEKDFCQGDSGGPLVCR    701 - 770
HENGPFVLYGIVSWGAGCVQPWKPGVFARVMIFLDWIQSKINGPASLQTNNKCKTLKQQLPPPTPSPDSA    771 - 840
SWPGCCSEAELEKPRGFFPTPRYLLDYRGRLECSWVLRVSPSSMAKFTIEYLSLLGSPVCQDSVLIIYEE    841 - 910
RHSKRKTAGGLHGRRLYSMTFMSPGPLVRVTFHALVRGAFGISYIDLKVLGPKDSKITRLSQSSNREHLV    911 - 980
PCEDVLLTKPEGIMQIPRNSHRTTMGCQWRLVAPLNHIIQLNIINFPMKPTTFVCHGHLRVYEGFGPGKK    981 - 1050
LIASFAGTLAMILTKDILKREKLNFINTYIMHIWENSVYDNVRSVGKRKQKKFASNLSYSMEAEKSRIQV   1051 - 1120
PADLVPAKGSLSGS                                                           1121 - 1134
//

Text Mined References (2)

PMID Year Title
16541075 2006 The finished DNA sequence of human chromosome 12.
12838346 2003 Human and mouse proteases: a comparative genomic approach.