Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.82
PubTator Score 6.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease -1.535 1.1e-02
active ulcerative colitis -2.270 1.9e-02
adrenocortical carcinoma -3.297 9.5e-05
aldosterone-producing adenoma -1.680 4.6e-02
astrocytic glioma 1.500 4.1e-02
cystic fibrosis -1.400 1.3e-03
ependymoma 2.100 3.3e-02
nasopharyngeal carcinoma -1.600 2.5e-04
non-small cell lung cancer 1.590 8.8e-09
oligodendroglioma 1.800 7.2e-03
ovarian cancer -1.100 4.9e-02
periodontitis -1.200 3.7e-24
Pick disease 1.300 1.9e-02
psoriasis 1.800 2.6e-44
spina bifida -1.825 3.9e-02

Synonym

Accession Q7RTY1 Q6ZMI2 Q9UFH8 MCT 9
Symbols MCT9
C10orf36

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

AA Sequence

MELKKSPDGGWGWVIVFVSFLTQFLCYGSPLAVGVLYIEWLDAFGEGKGKTAWVGSLASGVGLLASPVCS      1 - 70
LCVSSFGARPVTIFSGFMVAGGLMLSSFAPNIYFLFFSYGIVVGLGCGLLYTATVTITCQYFDDRRGLAL     71 - 140
GLISTGSSVGLFIYAALQRMLVEFYGLDGCLLIVGALALNILACGSLMRPLQSSDCPLPKKIAPEDLPDK    141 - 210
YSIYNEKGKNLEENINILDKSYSSEEKCRITLANGDWKQDSLLHKNPTVTHTKEPETYKKKVAEQTYFCK    211 - 280
QLAKRKWQLYKNYCGETVALFKNKVFSALFIAILLFDIGGFPPSLLMEDVARSSNVKEEEFIMPLISIIG    281 - 350
IMTAVGKLLLGILADFKWINTLYLYVATLIIMGLALCAIPFAKSYVTLALLSGILGFLTGNWSIFPYVTT    351 - 420
KTVGIEKLAHAYGILMFFAGLGNSLGPPIVGWFYDWTQTYDIAFYFSGFCVLLGGFILLLAALPSWDTCN    421 - 490
KQLPKPAPTTFLYKVASNV                                                       491 - 509
//

Text Mined References (20)

PMID Year Title