Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.92
PubTator Score 6.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 2.647781089353E-44
periodontitis 269 3.72769853560203E-24
posterior fossa group B ependymoma 1530 1.08862154992486E-12
non-small cell lung cancer 2798 8.7580944269057E-9
ulcerative colitis 2087 2.04336405317832E-5
adrenocortical carcinoma 1427 9.47350149180971E-5
nasopharyngeal carcinoma 1056 2.47015615969343E-4
cystic fibrosis 1670 0.00133031845298739
oligodendroglioma 2849 0.00717888060484213
active Crohn's disease 918 0.0113664014343641
Pick disease 1893 0.0191292797597614
spina bifida 1064 0.0387130450924992
astrocytic glioma 2241 0.0411121981835193
aldosterone-producing adenoma 664 0.0459691331775597
ovarian cancer 8492 0.0488143601401964
Disease Target Count Z-score Confidence
Gout 93 4.207 2.1
Disease Target Count Z-score Confidence
Hyperuricemia 35 3.456 1.7

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.500 0.041
posterior fossa group B ependymoma 2.300 0.000
oligodendroglioma 1.800 0.007
periodontitis -1.200 0.000
adrenocortical carcinoma -3.297 0.000
non-small cell lung cancer 1.590 0.000
active Crohn's disease -1.535 0.011
ulcerative colitis -3.300 0.000
cystic fibrosis -1.400 0.001
aldosterone-producing adenoma -1.680 0.046
nasopharyngeal carcinoma -1.600 0.000
spina bifida -1.825 0.039
Pick disease 1.300 0.019
ovarian cancer -1.100 0.049
psoriasis 1.800 0.000

Synonym

Accession Q7RTY1 Q6ZMI2 Q9UFH8 MCT 9
Symbols MCT9
C10orf36

Gene

PANTHER Protein Class (1)

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG
Zebrafish OMA Inparanoid

Gene RIF (9)

PMID Text
24824278 Strong association of SLC16A9 gene variation with HBsAg loss was identified in Chronic Hepatitis B patients treated with peginterferon and adefovir.
23990105 it has a possible physiological role in urate excretion from human intestinal epithelial cells.
20162743 Observational study of gene-disease association. (HuGE Navigator)
20162742 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20037589 Observational study of gene-disease association. (HuGE Navigator)
19890391 Observational study of gene-disease association. (HuGE Navigator)
19861489 Observational study of gene-disease association. (HuGE Navigator)
19503597 Meta-analysis of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MELKKSPDGGWGWVIVFVSFLTQFLCYGSPLAVGVLYIEWLDAFGEGKGKTAWVGSLASGVGLLASPVCS      1 - 70
LCVSSFGARPVTIFSGFMVAGGLMLSSFAPNIYFLFFSYGIVVGLGCGLLYTATVTITCQYFDDRRGLAL     71 - 140
GLISTGSSVGLFIYAALQRMLVEFYGLDGCLLIVGALALNILACGSLMRPLQSSDCPLPKKIAPEDLPDK    141 - 210
YSIYNEKGKNLEENINILDKSYSSEEKCRITLANGDWKQDSLLHKNPTVTHTKEPETYKKKVAEQTYFCK    211 - 280
QLAKRKWQLYKNYCGETVALFKNKVFSALFIAILLFDIGGFPPSLLMEDVARSSNVKEEEFIMPLISIIG    281 - 350
IMTAVGKLLLGILADFKWINTLYLYVATLIIMGLALCAIPFAKSYVTLALLSGILGFLTGNWSIFPYVTT    351 - 420
KTVGIEKLAHAYGILMFFAGLGNSLGPPIVGWFYDWTQTYDIAFYFSGFCVLLGGFILLLAALPSWDTCN    421 - 490
KQLPKPAPTTFLYKVASNV                                                       491 - 509
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24824278 2014 HBsAg loss in patients treated with peginterferon alfa-2a and adefovir is associated with SLC16A9 gene variation and lower plasma carnitine levels.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
23990105 2013 Common missense variant of monocarboxylate transporter 9 (MCT9/SLC16A9) gene is associated with renal overload gout, but not with all gout susceptibility.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
20162743 2010 Common variants in SLC17A3 gene affect intra-personal variation in serum uric acid levels in longitudinal time series.
20162742 2010 Predictive value of 8 genetic loci for serum uric acid concentration.
20037589 2010 A genome-wide perspective of genetic variation in human metabolism.
More...