Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.87
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q7RTY0 A3KMG3 A5PKU5 Q2VP92 MCT 13
Symbols MCT13

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
23945395 Data identified three new loci for type 2 diabetes with genome-wide significance: MIR129-LEP, GPSM1 and SLC16A13.

AA Sequence

MARRTEPPDGGWGWVVVLSAFFQSALVFGVLRSFGVFFVEFVAAFEEQAARVSWIASIGIAVQQFGSPVG      1 - 70
SALSTKFGPRPVVMTGGILAALGMLLASFATSLTHLYLSIGLLSGSGWALTFAPTLACLSCYFSRRRSLA     71 - 140
TGLALTGVGLSSFTFAPFFQWLLSHYAWRGSLLLVSALSLHLVACGALLRPPSLAEDPAVGGPRAQLTSL    141 - 210
LHHGPFLRYTVALTLINTGYFIPYLHLVAHLQDLDWDPLPAAFLLSVVAISDLVGRVVSGWLGDAVPGPV    211 - 280
TRLLMLWTTLTGVSLALFPVAQAPTALVALAVAYGFTSGALAPLAFSVLPELIGTRRIYCGLGLLQMIES    281 - 350
IGGLLGPPLSGYLRDVTGNYTASFVVAGAFLLSGSGILLTLPHFFCFSTTTSGPQDLVTEALDTKVPLPK    351 - 420
EGLEED                                                                    421 - 426
//

Text Mined References (5)

PMID Year Title
24390345 2014 Sequence variants in SLC16A11 are a common risk factor for type 2 diabetes in Mexico.
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12739169 2004 The SLC16 gene family-from monocarboxylate transporters (MCTs) to aromatic amino acid transporters and beyond.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.