Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.08
PubTator Score 2.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia -1.500 1.1e-02
adult high grade glioma -1.200 1.4e-03
astrocytic glioma -1.400 1.6e-02
Atopic dermatitis 1.300 1.1e-03
atypical teratoid / rhabdoid tumor -1.200 6.4e-03
cystic fibrosis 3.600 8.2e-06
glioblastoma -1.300 2.5e-03
intraductal papillary-mucinous adenoma (... -2.500 1.7e-03
intraductal papillary-mucinous carcinoma... -2.800 1.4e-03
medulloblastoma, large-cell -2.000 6.6e-07
non-small cell lung cancer 1.332 3.2e-05
osteosarcoma -1.789 1.4e-02
pituitary cancer 2.000 1.4e-06
ulcerative colitis 2.100 6.3e-04
urothelial carcinoma 1.600 2.6e-02

Gene RIF (1)

AA Sequence

MYTSHEDIGYDFEDGPKDKKTLKPHPNIDGGWAWMMVLSSFFVHILIMGSQMALGVLNVEWLEEFHQSRG      1 - 70
LTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAANVHYLFITFGVAAGLGSGM     71 - 140
AYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAVSLNLCVCGALMR    141 - 210
PLSPGKNPNDPGEKDVRGLPAHSTESVKSTGQQGRTEEKDGGLGNEETLCDLQAQECPDQAGHRKNMCAL    211 - 280
RILKTVSWLTMRVRKGFEDWYSGYFGTASLFTNRMFVAFIFWALFAYSSFVIPFIHLPEIVNLYNLSEQN    281 - 350
DVFPLTSIIAIVHIFGKVILGVIADLPCISVWNVFLLANFTLVLSIFILPLMHTYAGLAVICALIGFSSG    351 - 420
YFSLMPVVTEDLVGIEHLANAYGIIICANGISALLGPPFAGWIYDITQKYDFSFYICGLLYMIGILFLLI    421 - 490
QPCIRIIEQSRRKYMDGAHV                                                      491 - 510
//

Text Mined References (7)

PMID Year Title