Property Summary

NCBI Gene PubMed Count 6
Grant Count 5
R01 Count 5
Funding $530,774
PubMed Score 0.89
PubTator Score 0.97

Knowledge Summary

Patent (3,539)

Expression

Gene RIF (3)

PMID Text
20546612 Observational study of gene-disease association. (HuGE Navigator)
19343178 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
12932298 Catsper4 has a single channel-forming domain, a pore-loop with the consensus sequence TxDxW, & a coiled-coil protein-protein interaction domain in the C-terminal tail. CatSpers 1,2,3 & 4 may interact directly or indirectly to form a functional tetramer.

AA Sequence

MRDNEKAWWQQWTSHTGLEGWGGTQEDRMGFGGAVAALRGRPSPLQSTIHESYGRPEEQVLINRQEITNK      1 - 70
ADAWDMQEFITHMYIKQLLRHPAFQLLLALLLVINAITIALRTNSYLDQKHYELFSTIDDIVLTILLCEV     71 - 140
LLGWLNGFWIFWKDGWNILNFIIVFILLLRFFINEINIPSINYTLRALRLVHVCMAVEPLARIIRVILQS    141 - 210
VPDMANIMVLILFFMLVFSVFGVTLFGAFVPKHFQNIQVALYTLFICITQDGWVDIYSDFQTEKREYAME    211 - 280
IGGAIYFTIFITIGAFIGINLFVIVVTTNLEQMMKAGEQGQQQRITFSETGAEEEEENDQLPLVHCVVAR    281 - 350
SEKSGLLQEPLAGGPLSNLSENTCDNFCLVLEAIQENLRQYKEIRDELNMIVEEVRAIRFNQEQESEVLN    351 - 420
RRSSTSGSLETTSSKDIRQMSQQQDLLSALVSMEKVHDSSSQILLKKHKSSH                      421 - 472
//

Text Mined References (12)

PMID Year Title
26989199 2016 Unconventional endocannabinoid signaling governs sperm activation via the sex hormone progesterone.
21412339 2011 Progesterone activates the principal Ca2+ channel of human sperm.
21412338 2011 The CatSper channel mediates progesterone-induced Ca2+ influx in human sperm.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
19343178 2009 Meta-analysis of genome-wide scans for human adult stature identifies novel Loci and associations with measures of skeletal frame size.
17347248 2007 Expression of CatSper family transcripts in the mouse testis during post-natal development and human ejaculated spermatozoa: relationship to sperm motility.
17227845 2007 All four CatSper ion channel proteins are required for male fertility and sperm cell hyperactivated motility.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16382101 2005 International Union of Pharmacology. L. Nomenclature and structure-function relationships of CatSper and two-pore channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...