Property Summary

NCBI Gene PubMed Count 24
Grant Count 38
R01 Count 30
Funding $2,220,303.26
PubMed Score 50.78
PubTator Score 61.53

Knowledge Summary

Patent (38,597)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 0.001
psoriasis -1.100 0.000

Gene RIF (13)

PMID Text
24214976 A complex molecular mechanism involving changes in the properties of both the orthosteric and non-orthosteric sites of T1R1 underlies the determination of ligand specificity in mammalian T1R1/T1R3.
24000232 The study provides human psychophysical evidence that TAS1R1 polymorphisms associate with modest differences in overall taste intensity, which were independent from other well-studied markers of variation in oral sensation.
22427794 Data show that that Tas1r1 and Tas1r3 are expressed in murine and human spermatozoa.
21422378 amino acid substitutions (A110V and R507Q) in the N-terminal ligand-binding domain of T1R1 severely impair receptor functions in vitro
20660057 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
19587085 Observational study of gene-disease association. (HuGE Navigator)
19571223 In our sample of subjects, the frequencies of 2 nsSNPs, C329T in tas1r1 and C2269T in tas1r3, were significantly higher in [glutamate] nontasters than expected, whereas G1114A in tas1r1 was more frequent in tasters.
19146926 Taken together, these results suggest that Tas1R1-Tas1R3 receptor variants found in human fungiform papillae might contribute to inter-individual differences of sensitivity to L-glutamate.
17724330 human duodenal L cells express sweet taste receptor T1r.
More...

AA Sequence

MLLCTARLVGLQLLISCCWAFACHSTESSPDFTLPGDYLLAGLFPLHSGCLQVRHRPEVTLCDRSCSFNE      1 - 70
HGYHLFQAMRLGVEEINNSTALLPNITLGYQLYDVCSDSANVYATLRVLSLPGQHHIELQGDLLHYSPTV     71 - 140
LAVIGPDSTNRAATTAALLSPFLVPMISYAASSETLSVKRQYPSFLRTIPNDKYQVETMVLLLQKFGWTW    141 - 210
ISLVGSSDDYGQLGVQALENQATGQGICIAFKDIMPFSAQVGDERMQCLMRHLAQAGATVVVVFSSRQLA    211 - 280
RVFFESVVLTNLTGKVWVASEAWALSRHITGVPGIQRIGMVLGVAIQKRAVPGLKAFEEAYARADKKAPR    281 - 350
PCHKGSWCSSNQLCRECQAFMAHTMPKLKAFSMSSAYNAYRAVYAVAHGLHQLLGCASGACSRGRVYPWQ    351 - 420
LLEQIHKVHFLLHKDTVAFNDNRDPLSSYNIIAWDWNGPKWTFTVLGSSTWSPVQLNINETKIQWHGKDN    421 - 490
QVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGTFLNKSDLYRCQPCGKEEWAPEGSQTCFPRTVVFL    491 - 560
ALREHTSWVLLAANTLLLLLLLGTAGLFAWHLDTPVVRSAGGRLCFLMLGSLAAGSGSLYGFFGEPTRPA    561 - 630
CLLRQALFALGFTIFLSCLTVRSFQLIIIFKFSTKVPTFYHAWVQNHGAGLFVMISSAAQLLICLTWLVV    631 - 700
WTPLPAREYQRFPHLVMLECTETNSLGFILAFLYNGLLSISAFACSYLGKDLPENYNEAKCVTFSLLFNF    701 - 770
VSWIAFFTTASVYDGKYLPAANMMAGLSSLSSGFGGYFLPKCYVILCRPDLNSTEHFQASIQDYTRRCGS    771 - 840
T//

Text Mined References (25)

PMID Year Title
24214976 2013 Two distinct determinants of ligand specificity in T1R1/T1R3 (the umami taste receptor).
24000232 2013 Do polymorphisms in the TAS1R1 gene contribute to broader differences in human taste intensity?
22427794 2012 Expression of Tas1 taste receptors in mammalian spermatozoa: functional role of Tas1r1 in regulating basal Ca²? and cAMP concentrations in spermatozoa.
21738478 2011 Identification of nine novel loci associated with white blood cell subtypes in a Japanese population.
21422378 2011 Human genetic polymorphisms in T1R1 and T1R3 taste receptor subunits affect their function.
20660057 2010 Association between common variation in genes encoding sweet taste signaling components and human sucrose perception.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
19962942 2010 Functional crosstalk between GPCRs: with or without oligomerization.
19696921 2009 Genetic and molecular basis of individual differences in human umami taste perception.
19625681 2009 Variation in umami perception and in candidate genes for the umami receptor in mice and humans.
More...