Property Summary

NCBI Gene PubMed Count 41
Grant Count 148
R01 Count 94
Funding $13,452,978.45
PubMed Score 165.37
PubTator Score 75.20

Knowledge Summary

Patent (67,342)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.000

Synonym

Accession Q7RTX0 Q5TA49 Q8NGW9
Symbols T1R3

Gene

Gene RIF (33)

PMID Text
26422579 T1R3 gene expression in the tongue is suppressed by chemotherapy.
26168276 The transcripts of TAS1R3 and UCN2 in peripheral blood cells may be considered potential biomarkers of consumption of sugary and fatty food, respectively, to complement data of food-intake questionnaires.
25924601 TAS1R3 gene rs307355 polymorphism found independent risk factor for dental caries experience by logistic regression & increased risk of caries. Moderate caries (4-7 caries) found to be associated w/TAS1R3 rs307355 heterozygous genotype
25029362 human and mouse membrane trafficking systems for sweet taste receptors T1r2 and T1r3
24214976 A complex molecular mechanism involving changes in the properties of both the orthosteric and non-orthosteric sites of T1R1 underlies the determination of ligand specificity in mammalian T1R1/T1R3.
24068707 effects of artificial sweeteners on adipose tissue may be largely independent of the classical sweet taste receptors, T1R2 and T1R3
23370115 Five amino acid residues in cysteine-rich domain of human T1R3 were involved in the response for sweet-tasting protein, thaumatin
22773945 T1R3 is a receptor responsible for the detection of calcium by taste.
22450161 Overexpressed the human N-terminal domain of T1R3 in E. coli and found that the refolded protein behaves as a dimer; showed that hT1R3-NTD is functional and capable of binding sucralose with an affinity in the millimolar range.
22427794 Data show that that Tas1r1 and Tas1r3 are expressed in murine and human spermatozoa.
More...

AA Sequence

MLGPAVLGLSLWALLHPGTGAPLCLSQQLRMKGDYVLGGLFPLGEAEEAGLRSRTRPSSPVCTRFSSNGL      1 - 70
LWALAMKMAVEEINNKSDLLPGLRLGYDLFDTCSEPVVAMKPSLMFLAKAGSRDIAAYCNYTQYQPRVLA     71 - 140
VIGPHSSELAMVTGKFFSFFLMPQVSYGASMELLSARETFPSFFRTVPSDRVQLTAAAELLQEFGWNWVA    141 - 210
ALGSDDEYGRQGLSIFSALAAARGICIAHEGLVPLPRADDSRLGKVQDVLHQVNQSSVQVVLLFASVHAA    211 - 280
HALFNYSISSRLSPKVWVASEAWLTSDLVMGLPGMAQMGTVLGFLQRGAQLHEFPQYVKTHLALATDPAF    281 - 350
CSALGEREQGLEEDVVGQRCPQCDCITLQNVSAGLNHHQTFSVYAAVYSVAQALHNTLQCNASGCPAQDP    351 - 420
VKPWQLLENMYNLTFHVGGLPLRFDSSGNVDMEYDLKLWVWQGSVPRLHDVGRFNGSLRTERLKIRWHTS    421 - 490
DNQKPVSRCSRQCQEGQVRRVKGFHSCCYDCVDCEAGSYRQNPDDIACTFCGQDEWSPERSTRCFRRRSR    491 - 560
FLAWGEPAVLLLLLLLSLALGLVLAALGLFVHHRDSPLVQASGGPLACFGLVCLGLVCLSVLLFPGQPSP    561 - 630
ARCLAQQPLSHLPLTGCLSTLFLQAAEIFVESELPLSWADRLSGCLRGPWAWLVVLLAMLVEVALCTWYL    631 - 700
VAFPPEVVTDWHMLPTEALVHCRTRSWVSFGLAHATNATLAFLCFLGTFLVRSQPGCYNRARGLTFAMLA    701 - 770
YFITWVSFVPLLANVQVVLRPAVQMGALLLCVLGILAAFHLPRCYLLMRQPGLNTPEFFLGGGPGDAQGQ    771 - 840
NDGNTGNQGKHE                                                              841 - 852
//

Text Mined References (41)

PMID Year Title
26422579 2016 Effects of chemotherapy on gene expression of lingual taste receptors in patients with head and neck cancer.
26375852 2015 Rubemamine and Rubescenamine, Two Naturally Occurring N-Cinnamoyl Phenethylamines with Umami-Taste-Modulating Properties.
26168276 2015 TAS1R3 and UCN2 Transcript Levels in Blood Cells Are Associated With Sugary and Fatty Food Consumption in Children.
25924601 2015 Association of sweet taste receptor gene polymorphisms with dental caries experience in school children.
25248559 2014 Structure, function, and signaling of taste G-protein-coupled receptors.
25029362 2014 Distinct human and mouse membrane trafficking systems for sweet taste receptors T1r2 and T1r3.
24360415 2014 The taste of D- and L-amino acids: In vitro binding assays with cloned human bitter (TAS2Rs) and sweet (TAS1R2/TAS1R3) receptors.
24214976 2013 Two distinct determinants of ligand specificity in T1R1/T1R3 (the umami taste receptor).
24068707 2013 Artificial sweeteners stimulate adipogenesis and suppress lipolysis independently of sweet taste receptors.
23370115 2013 Five amino acid residues in cysteine-rich domain of human T1R3 were involved in the response for sweet-tasting protein, thaumatin.
More...