Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.35
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 2.080 0.000
juvenile dermatomyositis 1.021 0.000
acute quadriplegic myopathy 1.013 0.000
diabetes mellitus -1.100 0.013
group 4 medulloblastoma -1.100 0.001
posterior fossa group B ependymoma 1.100 0.000
subependymal giant cell astrocytoma 1.057 0.015
ulcerative colitis 1.600 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q7RTV5 B2RMW4 Q5JU02
Symbols C9orf21

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVVVFVRHFLCYI      1 - 70
CKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASS     71 - 140
GQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRDRNRLDHKPINSVLQLV    141 - 210
GVQHVNFTNRPSVIHV                                                          211 - 226
//

Text Mined References (6)

PMID Year Title
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14710190 2004 Reconsidering the evolution of eukaryotic selenoproteins: a novel nonmammalian family with scattered phylogenetic distribution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12234665 2002 Fugu and human sequence comparison identifies novel human genes and conserved non-coding sequences.