Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.35
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.013 3.2e-06
diabetes mellitus -1.100 1.3e-02
group 4 medulloblastoma -1.100 1.1e-03
juvenile dermatomyositis 1.021 1.2e-10
osteosarcoma 2.080 7.0e-06
ovarian cancer 1.100 3.6e-05
posterior fossa group B ependymoma 1.100 4.8e-04
subependymal giant cell astrocytoma 1.057 1.5e-02
ulcerative colitis 1.600 9.5e-08

AA Sequence

MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVVVFVRHFLCYI      1 - 70
CKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASS     71 - 140
GQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRDRNRLDHKPINSVLQLV    141 - 210
GVQHVNFTNRPSVIHV                                                          211 - 226
//

Text Mined References (6)

PMID Year Title