Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.65
PubTator Score 9.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Hypertension 396 0.0 0.0
Disease Target Count
Hypertensive disease 292
Disease Target Count P-value
non-inflammatory breast cancer 66 1.1e-02

Synonym

Accession Q7RTV2 Q5SZC2
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (6)

AA Sequence

MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEIDGMKLVQTRA      1 - 70
ILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDAKTALVKEKIKNRYFPAFEKVL     71 - 140
KSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSQRKPPMDE    141 - 210
KSLEEARKIFRF                                                              211 - 222
//

Text Mined References (9)

PMID Year Title