Property Summary

NCBI Gene PubMed Count 9
Grant Count 3
Funding $104,022.6
PubMed Score 10.63
PubTator Score 9.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q7RTV2 Q5SZC2
Symbols

Gene

Gene RIF (6)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)
20200426 We observed suggestive associations between survival and GSTT1 copy number and GSTA5, GSTM4, and ABCC4 single nucleotide polymorphisms
20200426 Observational study of gene-disease association. (HuGE Navigator)
19664689 Data show that hGSTA5 can be processed to a mature mRNA which is translation-competent, producing a catalytically active enzyme.
18977241 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEIDGMKLVQTRA      1 - 70
ILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDAKTALVKEKIKNRYFPAFEKVL     71 - 140
KSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSQRKPPMDE    141 - 210
KSLEEARKIFRF                                                              211 - 222
//

Text Mined References (9)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20200426 2010 Glutathione pathway genetic polymorphisms and lung cancer survival after platinum-based chemotherapy.
19664689 2010 The human hGSTA5 gene encodes an enzymatically active protein.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12042665 2002 The human glutathione transferase alpha locus: genomic organization of the gene cluster and functional characterization of the genetic polymorphism in the hGSTA1 promoter.
10676639 2000 Quantitative analysis of interindividual variation of glutathione S-transferase expression in human pancreas and the ambiguity of correlating genotype with phenotype.