Property Summary

NCBI Gene PubMed Count 13
Grant Count 30
R01 Count 15
Funding $5,768,810.53
PubMed Score 344.14
PubTator Score 137.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (6)

PMID Text
24157418 These studies identify an important role for Scx in regulating proteoglycans in embryonic and mature valve cells.
22796342 Scleraxis thus appears to play a key role in the transcriptional regulation of type I collagen synthesis.
21988170 collagen type I and several T/L-related proteoglycans were upregulated in hMSC-Scx cells
19828133 Scx and E47 might modulate the primary chondrogenesis by associating with the Sox9-related transcriptional complex, and by binding to the conserved E-box on Col2a1 promoter.
19087640 High glucose inhibited osteogenetic differentiation of periodontal ligament cells and up-regulated Scleraxis expression.
17129431 Scleraxis was expressed in periodontal ligament cells, bone marrow cells, and gingival fibroblasts, and may play an important role in differentiation of periodontal ligament cells.

AA Sequence

MSFATLRPAPPGRYLYPEVSPLSEDEDRGSDSSGSDEKPCRVHAARCGLQGARRRAGGRRAGGGGPGGRP      1 - 70
GREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLAGEACGDG     71 - 140
QPCHSGPAFFHAARAGSPPPPPPPPPARDGENTQPKQICTFCLSNQRKLSKDRDRKTAIRS             141 - 201
//

Text Mined References (13)

PMID Year Title
24157418 2013 Tgf?-Smad and MAPK signaling mediate scleraxis and proteoglycan expression in heart valves.
22796342 2012 Synergistic roles of scleraxis and Smads in the regulation of collagen 1?2 gene expression.
21988170 2012 Conversion of human bone marrow-derived mesenchymal stem cells into tendon progenitor cells by ectopic expression of scleraxis.
19828133 2010 Scleraxis and E47 cooperatively regulate the Sox9-dependent transcription.
19362560 2009 The basic helix-loop-helix transcription factor scleraxis regulates fibroblast collagen synthesis.
19087640 2008 [Effect of high glucose on the expression of transcription factor Scleraxis in periodontal ligament cells in vitro].
17129431 2006 [Expression of Scleraxis in human periodontal ligament cells and gingival fibroblasts].
16421571 2006 DNA sequence and analysis of human chromosome 8.
15338228 2004 Cultivation of human tenocytes in high-density culture.
12837285 2003 Establishment of tendon-derived cell lines exhibiting pluripotent mesenchymal stem cell-like property.
More...