Property Summary

NCBI Gene PubMed Count 14
PubMed Score 362.90
PubTator Score 137.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (7)

AA Sequence

MSFATLRPAPPGRYLYPEVSPLSEDEDRGSDSSGSDEKPCRVHAARCGLQGARRRAGGRRAGGGGPGGRP      1 - 70
GREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLAGEACGDG     71 - 140
QPCHSGPAFFHAARAGSPPPPPPPPPARDGENTQPKQICTFCLSNQRKLSKDRDRKTAIRS             141 - 201
//

Text Mined References (14)

PMID Year Title