Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Multiple Sclerosis 540 1.5e-02
Disease Target Count Z-score Confidence
oligodendroglioma 2850 3.143 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
Multiple Sclerosis 1.200 1.5e-02

AA Sequence

MPMGAAERGAGPQSSAAPWAGSEKAAKRGPSKSWYPRAAASDVTCPTGGDGADPKPGPFGGGLALGPAPR      1 - 70
GTMNNNFCRALVDRRPLGPPSCMQLGVMPPPRQAPLPPAEPLGNVPFLLYPGPAEPPYYDAYAGVFPYVP     71 - 140
FPGAFGVYEYPFEPAFIQKRNERERQRVKCVNEGYARLRGHLPGALAEKRLSKVETLRAAIRYIKYLQEL    141 - 210
LSSAPDGSTPPASRGLPGTGPCPAPPATPRPDRPGDGEARAPSSLVPESSESSCFSPSPFLESEESWH      211 - 278
//

Text Mined References (2)

PMID Year Title