Property Summary

NCBI Gene PubMed Count 0
Grant Count 1
Funding $111,093
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
Multiple Sclerosis 1.200 0.015

AA Sequence

MPMGAAERGAGPQSSAAPWAGSEKAAKRGPSKSWYPRAAASDVTCPTGGDGADPKPGPFGGGLALGPAPR      1 - 70
GTMNNNFCRALVDRRPLGPPSCMQLGVMPPPRQAPLPPAEPLGNVPFLLYPGPAEPPYYDAYAGVFPYVP     71 - 140
FPGAFGVYEYPFEPAFIQKRNERERQRVKCVNEGYARLRGHLPGALAEKRLSKVETLRAAIRYIKYLQEL    141 - 210
LSSAPDGSTPPASRGLPGTGPCPAPPATPRPDRPGDGEARAPSSLVPESSESSCFSPSPFLESEESWH      211 - 278
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14516699 2002 Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening.